RegulonDB RegulonDB 10.9: Gene Form
   

zapB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glpF rraA zapB GlpR CRP GlpR GlpR CRP GlpR TSS_4630 (cluster) TSS_4630 (cluster) TSS_4629 TSS_4629 TSS_4628 (cluster) TSS_4628 (cluster) TSS_4627 TSS_4627 TSS_4626 TSS_4626 TSS_4625 (cluster) TSS_4625 (cluster) TSS_4624 TSS_4624 zapBp1 zapBp1 glpFp glpFp

Gene      
Name: zapB    Texpresso search in the literature
Synonym(s): ECK3920, EG11878, b3928, yiiU
Genome position(nucleotides): 4118515 --> 4118760 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.37
External database links:  
ASAP:
ABE-0012835
ECHOBASE:
EB1824
ECOLIHUB:
zapB
OU-MICROARRAY:
b3928
STRING:
511145.b3928
COLOMBOS: zapB


Product      
Name: cell division factor ZapB
Synonym(s): YiiU, ZapB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.635
Isoelectric point: 4.368
Motif(s):
 
Type Positions Sequence
3 -> 80 MSLEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVQNAQHQREELERENNHLKEQQNGWQERLQALLGRMEE

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032153 - cell division site
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0043093 - FtsZ-dependent cytokinesis
GO:0000917 - division septum assembly
GO:0036214 - contractile ring localization
GO:0090529 - cell septum assembly
Note(s): Note(s): ...[more].
Reference(s): [1] Buss JA., et al., 2017
[2] Thiel A., et al., 2012
External database links:  
DIP:
DIP-35850N
ECOCYC:
EG11878-MONOMER
ECOLIWIKI:
b3928
INTERPRO:
IPR009252
PDB:
2JEE
PFAM:
PF06005
PRIDE:
P0AF36
PRODB:
PRO_000024246
REFSEQ:
NP_418363
SMR:
P0AF36
UNIPROT:
P0AF36


Operon      
Name: zapB         
Operon arrangement:
Transcription unit        Promoter
yiiU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter zapBp1 4118386 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_4624 4118427 forward nd [RS-EPT-CBR] [4]
  promoter TSS_4625 (cluster) 4118444 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_4626 4118479 forward nd [RS-EPT-CBR] [4]
  promoter TSS_4627 4118484 forward nd [RS-EPT-CBR] [4]
  promoter TSS_4628 (cluster) 4118502 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_4629 4118519 forward nd [RS-EPT-CBR] [4]
  promoter TSS_4630 (cluster) 4118531 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Buss JA., Peters NT., Xiao J., Bernhardt TG., 2017, ZapA and ZapB form an FtsZ-independent structure at midcell., Mol Microbiol 104(4):652-663

 [2] Thiel A., Valens M., Vallet-Gely I., Espeli O., Boccard F., 2012, Long-range chromosome organization in E. coli: a site-specific system isolates the Ter macrodomain., PLoS Genet 8(4):e1002672

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB