RegulonDB RegulonDB 10.10: Gene Form
   

rraA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

menA rraA zapB rraAp rraAp TSS_4631 TSS_4631 TSS_4630 (cluster) TSS_4630 (cluster) TSS_4629 TSS_4629

Gene      
Name: rraA    Texpresso search in the literature
Synonym(s): ECK3921, EG11879, b3929, menG, yiiV
Genome position(nucleotides): 4118845 <-- 4119330 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.26
External database links:  
ASAP:
ABE-0012837
ECHOBASE:
EB1825
ECOLIHUB:
rraA
OU-MICROARRAY:
b3929
STRING:
511145.b3929
COLOMBOS: rraA


Product      
Name: ribonuclease E inhibitor protein A
Synonym(s): MenG, RraA, YiiV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.36
Isoelectric point: 3.808
Motif(s):
 
Type Positions Sequence
5 -> 152 TSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGII

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.4 - RNA degradation
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0005515 - protein binding
GO:0008428 - ribonuclease inhibitor activity
GO:0019899 - enzyme binding
GO:0042802 - identical protein binding
GO:0060698 - endoribonuclease inhibitor activity
biological_process GO:1902369 - negative regulation of RNA catabolic process
GO:0051252 - regulation of RNA metabolic process
GO:0060699 - regulation of endoribonuclease activity
GO:0060702 - negative regulation of endoribonuclease activity
GO:0070207 - protein homotrimerization
Note(s): Note(s): ...[more].
Reference(s): [1] Horinouchi T., et al., 2017
External database links:  
DIP:
DIP-35864N
ECOCYC:
EG11879-MONOMER
ECOLIWIKI:
b3929
INTERPRO:
IPR005493
INTERPRO:
IPR010203
INTERPRO:
IPR014339
INTERPRO:
IPR036704
MODBASE:
P0A8R0
PDB:
2YJV
PDB:
2YJT
PDB:
1Q5X
PFAM:
PF03737
PRIDE:
P0A8R0
PRODB:
PRO_000023875
REFSEQ:
NP_418364
SMR:
P0A8R0
UNIPROT:
P0A8R0


Operon      
Name: menA-rraA         
Operon arrangement:
Transcription unit        Promoter
rraA
menA-rraA
menA-rraA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4629 4118519 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4630 (cluster) 4118531 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4631 4119356 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Horinouchi T., Sakai A., Kotani H., Tanabe K., Furusawa C., 2017, Improvement of isopropanol tolerance of Escherichia coli using adaptive laboratory evolution and omics technologies., J Biotechnol 255:47-56

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB