RegulonDB RegulonDB 10.9: Gene Form
   

pdeC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeC soxS yjcB SoxR yjcCp yjcCp TSS_4898 (cluster) TSS_4898 (cluster) yjcBp yjcBp

Gene      
Name: pdeC    Texpresso search in the literature
Synonym(s): ECK4053, EG11938, b4061, yjcC
Genome position(nucleotides): 4275471 --> 4277057 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.74
External database links:  
ASAP:
ABE-0013309
ECHOBASE:
EB1882
ECOLIHUB:
yjcC
OU-MICROARRAY:
b4061
STRING:
511145.b4061
COLOMBOS: pdeC


Product      
Name: c-di-GMP phosphodiesterase PdeC
Synonym(s): PdeC, YjcC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space,cytosol
Molecular weight: 60.801
Isoelectric point: 8.565
Motif(s):
 
Type Positions Sequence
268 -> 520 YLSPKRKLQRALEKHQLCLYYQPIIDIKTEKCIGAEALLRWPGEQGQIMNPAEFIPLAEKEGMIEQITDYVIDNVFRDLGDYLATHADRYVSINLSASDFHTSRLIARINQKTEQYAVRPQQIKFEVTEHAFLDVDKMTPIILAFRQAGYEVAIDDFGIGYSNLHNLKSLNVDILKIDKSFVETLTTHKTSHLIAEHIIELAHSLGLKTIAEGVETEEQVNWLRKRGVRYCQGWFFAKAMPPQVFMQWMEQLP
14 -> 34 GIIFLVLFPIILSLWIAFLWA
106 -> 106 C
40 -> 243 NQLRTFAQLALDKSELVIRQADLVSDAAERYQGQVCTPAHQKRMLNIIRGYLYINELIYARDNHFLCSSLIAPVNGYTIAPADYKREPNVSIYYYRDTPFFSGYKMTYMQRGNYVAVINPLFWSEVMSDDPTLQWGVYDTVTKTFFSLSKEASAATFSPLIHLKDLTVQRNGYLYATVYSTKRPIAAIVATSYQRLITHFYNHL
75 -> 75 C

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016787 - hydrolase activity
GO:0071111 - cyclic-guanylate-specific phosphodiesterase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Sarenko O., et al., 2017
External database links:  
DIP:
DIP-12548N
ECOCYC:
EG11938-MONOMER
ECOLIWIKI:
b4061
INTERPRO:
IPR024744
INTERPRO:
IPR035919
INTERPRO:
IPR001633
PFAM:
PF00563
PFAM:
PF12792
PRIDE:
P32701
PROSITE:
PS50883
REFSEQ:
NP_418485
SMART:
SM00052
SMR:
P32701
UNIPROT:
P32701


Operon      
Name: pdeC         
Operon arrangement:
Transcription unit        Promoter
yjcC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4898 (cluster) 4275402 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sarenko O., Klauck G., Wilke FM., Pfiffer V., Richter AM., Herbst S., Kaever V., Hengge R., 2017, More than Enzymes That Make or Break Cyclic Di-GMP-Local Signaling in the Interactome of GGDEF/EAL Domain Proteins of Escherichia coli., MBio 8(5)

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB