RegulonDB RegulonDB 11.0: Gene Form
   

yjcO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fdhF gltP yjcO Cis-reg terminator TSS_4903 TSS_4903 yjcOp3 yjcOp3 yjcOp5 yjcOp5 yjcOp2 yjcOp2 yjcOp4 yjcOp4

Gene      
Name: yjcO    Texpresso search in the literature
Synonym(s): ECK4071, EG11951, b4078
Genome position(nucleotides): 4296436 <-- 4297125
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.71
External database links:  
ASAP:
ABE-0013360
ECHOBASE:
EB1894
ECOLIHUB:
yjcO
OU-MICROARRAY:
b4078
STRING:
511145.b4078
COLOMBOS: yjcO


Product      
Name: Sel1 repeat-containing protein YjcO
Synonym(s): YjcO
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 25.079
Isoelectric point: 4.507
Motif(s):
 
Type Positions Sequence Comment
1 -> 17 MKKIIALMLFLTFFAHA
18 -> 229 NDSEPGSQYLKAAEAGDRRAQYFLADSWFSSGDLSKAEYWAQKAADSGDADACALLAQIKITNPVSLDYPQAKVLAEKAAQAGSKEGEVTLAHILVNTQAGKPDYPKAISLLENASEDLENDSAVDAQMLLGLIYANGVGIKADDDKATWYFKRSSAISRTGYSEYWAGMMFLNGEEGFIEKNKQKALHWLNLSCMEGFDTGCEEFEKLTNG UniProt: Sel1-repeat-containing protein YjcO.
48 -> 66 SGDLSKAEYWAQKAADSGD UniProt: Sel1-like 1.
85 -> 101 DYPQAKVLAEKAAQAGS
143 -> 173 DAQMLLGLIYANGVGIKADDDKATWYFKRSS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P0AF56
ECOCYC:
EG11951-MONOMER
ECOLIWIKI:
b4078
INTERPRO:
IPR011990
INTERPRO:
IPR006597
MODBASE:
P0AF56
PFAM:
PF08238
PRIDE:
P0AF56
REFSEQ:
NP_418502
SMART:
SM00671
SMR:
P0AF56
UNIPROT:
P0AF56


Operon      
Name: yjcO         
Operon arrangement:
Transcription unit        Promoter
yjcO


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjcOp4 4297134 reverse nd [ICWHO] [1]
  promoter yjcOp2 4297151 reverse nd [ICWHO] [1]
  promoter yjcOp5 4297222 reverse nd [ICWHO] [1]
  promoter yjcOp3 4297330 reverse nd [ICWHO] [1]
  promoter TSS_4903 4299298 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB