RegulonDB RegulonDB 10.8: Gene Form
   

yadV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

htrE yadV yadN yadVp1 yadVp1 yadVp2 yadVp2 yadVp3 yadVp3 htrEp1 htrEp1 htrEp5 htrEp5

Gene      
Name: yadV    Texpresso search in the literature
Synonym(s): ECK0139, EG11973, b0140, ecpD
Genome position(nucleotides): 155461 <-- 156201 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.4
External database links:  
ASAP:
ABE-0000482
CGSC:
30513
ECHOBASE:
EB1916
OU-MICROARRAY:
b0140
PortEco:
ecpD
STRING:
511145.b0140
COLOMBOS: yadV


Product      
Name: putative fimbrial chaperone YadV
Synonym(s): EcpD, YadV
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 27.054
Isoelectric point: 9.677
Motif(s):
 
Type Positions Sequence
26 -> 246 DIVISGTRVIYKSDQKSVNVRLENKGNNPLLVQSWLDTGDDNAEPGSITVPFTATPPVSRIDAKRGQTIKLMYTASTSLPKDRESVFWFNVLEVPPKPDAEKVANQSLLQLAFRTRIKLFYRPDGLKGNPSEAPLALKWFWSGSEGKASLRVTNPTPYYVSFSSGDLEASGKRYPIDVKMIAPFSDEVMKVNGLNGKANSAKVHFYAINDFGGAIEGNARL
177 -> 240 VTNPTPYYVSFSSGDLEASGKRYPIDVKMIAPFSDEVMKVNGLNGKANSAKVHFYAINDFGGAI
1 -> 25 MFFNTKHTTALCFVTCMAFSSSSIA
79 -> 79 A
110 -> 111 SV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0071555 - cell wall organization
GO:0061077 - chaperone-mediated protein folding
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2011
[2] Larsonneur F., et al., 2016
[3] Raina S., et al., 1993
[4] Wurpel DJ., et al., 2013
External database links:  
DIP:
DIP-9492N
ECOCYC:
EG11973-MONOMER
ECOLIWIKI:
b0140
INTERPRO:
IPR016147
INTERPRO:
IPR036316
INTERPRO:
IPR018046
INTERPRO:
IPR016148
INTERPRO:
IPR013783
INTERPRO:
IPR008962
INTERPRO:
IPR001829
MINT:
MINT-1302192
MODBASE:
P33128
PDB:
5GHU
PFAM:
PF00345
PFAM:
PF02753
PRIDE:
P33128
PRINTS:
PR00969
PRODB:
PRO_000022501
PROSITE:
PS00635
REFSEQ:
NP_414682
SMR:
P33128
UNIPROT:
P33128


Operon      
Name: yadV-htrE         
Operon arrangement:
Transcription unit        Promoter
yadV-htrE
yadV-htrE
yadV-htrE


Transcriptional Regulation      
Display Regulation             
Activated by: IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter htrEp5 155438 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter htrEp1 155518 reverse Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [2] Larsonneur F., Martin FA., Mallet A., Martinez-Gil M., Semetey V., Ghigo JM., Beloin C., 2016, Functional analysis of Escherichia coli Yad fimbriae reveals their potential role in environmental persistence., Environ Microbiol 18(12):5228-5248

 [3] Raina S., Missiakas D., Baird L., Kumar S., Georgopoulos C., 1993, Identification and transcriptional analysis of the Escherichia coli htrE operon which is homologous to pap and related pilin operons., J Bacteriol 175(16):5009-21

 [4] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB