RegulonDB RegulonDB 11.0: Gene Form
   

ccmA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ccmC ccmB ccmA napC ccmD

Gene      
Name: ccmA    Texpresso search in the literature
Synonym(s): ECK2193, EG12059, b2201, yejW
Genome position(nucleotides): 2297021 <-- 2297644
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.93
External database links:  
ASAP:
ABE-0007279
CGSC:
36574
ECHOBASE:
EB1989
ECOLIHUB:
ccmA
OU-MICROARRAY:
b2201
STRING:
511145.b2201
COLOMBOS: ccmA


Product      
Name: cytochrome c maturation protein A
Synonym(s): CcmA, YejW, heme trafficking system protein A
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 23.053
Isoelectric point: 7.22
Motif(s):
 
Type Positions Sequence Comment
4 -> 207 LEARELLCERDERTLFSGLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRPDAGEVLWQGQPLHQVRDSYHQNLLWIGHQPGIKTRLTALENLHFYHRDGDTAQCLEALAQAGLAGFEDIPVNQLSAGQQRRVALARLWLTRATLWILDEPFTAIDVNGVDRLTQRMAQHTEQGGIVILTTHQPLNVAESKIRRISLTQTRAA UniProt: ABC transporter.
21 -> 156 GLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRPDAGEVLWQGQPLHQVRDSYHQNLLWIGHQPGIKTRLTALENLHFYHRDGDTAQCLEALAQAGLAGFEDIPVNQLSAGQQRRVALARLWLTRATLWILDEPF
36 -> 43 GSNGAGKT UniProt: ATP.
42 -> 42 K K → D: loss of ATPase actvity in vitro; loss of cytochrome c production in vivo although holo-CcmE is still formed
129 -> 133 LSAGQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031234 - extrinsic component of cytoplasmic side of plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATP hydrolysis activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015439 - ABC-type heme transporter activity
GO:0022857 - transmembrane transporter activity
biological_process GO:1903607 - cytochrome c biosynthetic process
GO:1904334 - heme import across plasma membrane
GO:0017004 - cytochrome complex assembly
Note(s): Note(s): ...[more].
Reference(s): [1] Cook GM., et al., 2000
External database links:  
ALPHAFOLD:
P33931
ECOCYC:
CCMA-MONOMER
ECOLIWIKI:
b2201
INTERPRO:
IPR017871
INTERPRO:
IPR027417
INTERPRO:
IPR005895
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MODBASE:
P33931
PANTHER:
PTHR43499
PFAM:
PF00005
PRIDE:
P33931
PRODB:
PRO_000022257
PROSITE:
PS50893
PROSITE:
PS00211
PROSITE:
PS51243
REFSEQ:
NP_416705
SMART:
SM00382
SMR:
P33931
UNIPROT:
P33931


Operon      
Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter
napFDAGHBC-ccmABCDEFGH
napFDAGHBC-ccmABCDEFGH
napFDAGHBC
ccmABCDEFGH


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, ModE, NarP, FlhDC
Repressed by: NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Cook GM., Poole RK., 2000, Oxidase and periplasmic cytochrome assembly in Escherichia coli K-12: CydDC and CcmAB are not required for haem-membrane association., Microbiology 146 ( Pt 2):527-36


RegulonDB