RegulonDB RegulonDB 11.0: Gene Form

napG gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

napA napH napG napB napD

Name: napG    Texpresso search in the literature
Synonym(s): ECK2197, EG12064, b2205, yojA, yojB
Genome position(nucleotides): 2299565 <-- 2300260
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: ferredoxin-type protein NapG
Synonym(s): NapG, YojA, YojB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,periplasmic space,inner membrane
Molecular weight: 24.925
Isoelectric point: 8.009
Type Positions Sequence Comment
11 -> 12 RR UniProt: Cannot complement a deletion mutant..
50 -> 81 GAINENAFASACVRCGQCVQACPYDTLKLATL UniProt: 4Fe-4S ferredoxin-type 1.


Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.3 - electron carriers
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0005886 - plasma membrane
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
Note(s): Note(s): ...[more].
External database links:  

Name: napFDAGHBC-ccmABCDEFGH         
Operon arrangement:
Transcription unit        Promoter

Transcriptional Regulation      
Display Regulation             
Activated by: FNR, ModE, NarP, FlhDC
Repressed by: IscR, NarL, NarP

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
