RegulonDB RegulonDB 10.9: Gene Form
   

chpB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ppa chpB yzfA ytfP chpS anti-anti-terminator anti-terminator terminator terminator anti-terminator anti-anti-terminator TSS_5080 (cluster) TSS_5080 (cluster) TSS_5079 TSS_5079 TSS_5078 TSS_5078 chpSp2 chpSp2 chpSp1 chpSp1 yzfAp2 yzfAp2

Gene      
Name: chpB    Texpresso search in the literature
Synonym(s): ECK4221, EG12096, b4225, chpBK, yjfE
Genome position(nucleotides): 4448692 --> 4449042 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.85
External database links:  
ASAP:
ABE-0013822
CGSC:
33290
ECHOBASE:
EB2020
ECOLIHUB:
chpB
OU-MICROARRAY:
b4225
STRING:
511145.b4225
COLOMBOS: chpB


Product      
Name: endoribonuclease toxin ChpB
Synonym(s): ChpB, ChpB toxin of the ChpB-ChpS toxin-antitoxin system, ChpBK, YjfE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.492
Isoelectric point: 5.563
Motif(s):
 
Type Positions Sequence
8 -> 114 ERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLVNQVRMMDLHARLAKRIGLAADEVVEEALLRLQAV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.4 - RNA degradation
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0016787 - hydrolase activity
GO:0003723 - RNA binding
GO:0004521 - endoribonuclease activity
GO:0016891 - endoribonuclease activity, producing 5'-phosphomonoesters
biological_process GO:0006402 - mRNA catabolic process
GO:0030308 - negative regulation of cell growth
GO:0043488 - regulation of mRNA stability
GO:0016075 - rRNA catabolic process
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0090502 - RNA phosphodiester bond hydrolysis, endonucleolytic
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12096-MONOMER
ECOLIWIKI:
b4225
INTERPRO:
IPR003477
INTERPRO:
IPR011067
MODBASE:
P33647
PANTHER:
PTHR33988
PFAM:
PF02452
PRIDE:
P33647
REFSEQ:
NP_418646
SWISSMODEL:
P33647
UNIPROT:
P33647


Operon      
Name: chpSB         
Operon arrangement:
Transcription unit        Promoter
chpSB
chpSB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5077 4447908 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_5078 4448430 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5079 4448709 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5080 (cluster) 4449647 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB