RegulonDB RegulonDB 10.9: Gene Form
   

yeiE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lysP yeiH yeiE SoxS Rob MarA ArgP ArgP terminator yeiEp5 yeiEp5 TSS_2461 TSS_2461 yeiHp7 yeiHp7 yeiEp6 yeiEp6 TSS_2460 TSS_2460 yeiEp7 yeiEp7 TSS_2459 TSS_2459 lysPp lysPp

Gene      
Name: yeiE    Texpresso search in the literature
Synonym(s): ECK2150, EG12105, b2157
Genome position(nucleotides): 2248737 <-- 2249618 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.74
External database links:  
ASAP:
ABE-0007138
ECHOBASE:
EB2029
ECOLIHUB:
yeiE
OU-MICROARRAY:
b2157
STRING:
511145.b2157
COLOMBOS: yeiE


Product      
Name: LysR-type transcriptional regulator YeiE
Synonym(s): YeiE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.724
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
86 -> 286 EDNGAIRIYASSTIGNYILPAVIARYRHDYPQLPIELSVGNSQDVMQAVLDFRVDIGFIEGPCHSTEIISEPWLEDELVVFAAPTSPLARGPVTLEQLAAAPWILRERGSGTREIVDYLLLSHLPKFEMAMELGNSEAIKHAVRHGLGISCLSRRVIEDQLQAGTLSEVAVPLPRLMRTLWRIHHRQKHLSNALRRFLDYC
1 -> 60 MHITLRQLEVFAEVLKSGSTTQASVMLALSQSAVSAALTDLEGQLGVQLFDRVGKRLVVN
5 -> 64 LRQLEVFAEVLKSGSTTQASVMLALSQSAVSAALTDLEGQLGVQLFDRVGKRLVVNEHGR
20 -> 39 TTQASVMLALSQSAVSAALT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
[IPI] Inferred from physical interaction
Reference(s): [1] Fujii T., et al., 2002
[2] Gao Y., et al., 2018
[3] Perez-Rueda E., et al., 2000
[4] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-11918N
ECOCYC:
EG12105-MONOMER
ECOLIWIKI:
b2157
INTERPRO:
IPR000847
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR005119
MODBASE:
P0ACR4
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P0ACR4
PRINTS:
PR00039
PROSITE:
PS50931
REFSEQ:
NP_416662
SMR:
P0ACR4
UNIPROT:
P0ACR4


Operon      
Name: yeiE         
Operon arrangement:
Transcription unit        Promoter
yeiE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2459 2249471 reverse nd [RS-EPT-CBR] [5]
  promoter yeiEp7 2249638 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter TSS_2460 2249642 reverse nd [RS-EPT-CBR] [5]
  promoter yeiEp6 2249656 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter yeiHp7 2249666 forward Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter TSS_2461 2249700 forward nd [RS-EPT-CBR] [5]
  promoter yeiEp5 2249711 reverse Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Fujii T., Aritoku Y., Agematu H., Tsunekawa H., 2002, Increase in the rate of L-pipecolic acid production using lat-expressing Escherichia coli by lysP and yeiE amplification., Biosci Biotechnol Biochem 66(9):1981-4

 [2] Gao Y., Yurkovich JT., Seo SW., Kabimoldayev I., Drager A., Chen K., Sastry AV., Fang X., Mih N., Yang L., Eichner J., Cho BK., Kim D., Palsson BO., 2018, Systematic discovery of uncharacterized transcription factors in Escherichia coli K-12 MG1655., Nucleic Acids Res 46(20):10682-10696

 [3] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [4] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB