RegulonDB RegulonDB 10.9: Gene Form
   

cbpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yccE cbpA torD cbpM torA Fis cbpAp6 cbpAp6 cbpAp4 cbpAp4 cbpAp1 cbpAp1 cbpAp2 cbpAp2 TSS_1313 TSS_1313 TSS_1312 TSS_1312

Gene      
Name: cbpA    Texpresso search in the literature
Synonym(s): ECK0991, EG12193, b1000
Genome position(nucleotides): 1062855 <-- 1063775 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.88
External database links:  
ASAP:
ABE-0003379
CGSC:
31822
ECHOBASE:
EB2110
ECOLIHUB:
cbpA
OU-MICROARRAY:
b1000
STRING:
511145.b1000
COLOMBOS: cbpA


Product      
Name: curved DNA-binding protein
Synonym(s): CbpA, co-chaperone CbpA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,bacterial nucleoid
Molecular weight: 34.455
Isoelectric point: 6.81
Motif(s):
 
Type Positions Sequence
30 -> 30 R
120 -> 276 IEIEVAVFLEETLTEHKRTISYNLPVYNAFGMIEQEIPKTLNVKIPAGVGNGQRIRLKGQGTPGENGGPNGDLWLVIHIAPHPLFDIVGQDLEIVVPVSPWEAALGAKVTVPTLKESILLTIPPGSQAGQRLRVKGKGLVSKKQTGDLYAVLKIVMP
5 -> 69 DYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYDQMW
26 -> 26 R
33 -> 33 H

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  2 - information transfer --> 2.3 - protein related --> 2.3.7 - nucleoproteins, basic proteins
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009295 - nucleoid
GO:0043590 - bacterial nucleoid
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0051082 - unfolded protein binding
GO:0003681 - bent DNA binding
GO:0042802 - identical protein binding
biological_process GO:0061992 - ATP-dependent chaperone mediated protein folding
GO:0006457 - protein folding
GO:0042026 - protein refolding
GO:0051085 - chaperone cofactor-dependent protein refolding
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IDA] Inferred from direct assay
[IGI] Inferred from genetic interaction
Reference(s): [1] Azam TA., et al., 2000
[2] Bird JG., et al., 2006
[3] Chae C., et al., 2004
[4] Chenoweth MR., et al., 2007
[5] Chenoweth MR., et al., 2008
[6] Chintakayala K., et al., 2011
[7] Chintakayala K., et al., 2015
[8] Chintakayala K., et al., 2013
[9] Cosgriff S., et al., 2010
[10] Gur E., et al., 2004
[11] Gur E., et al., 2005
[12] Meyer AS., et al., 2013
[13] Sarraf NS., et al., 2010
[14] Sarraf NS., et al., 2014
[15] Ueguchi C., et al., 1994
[16] Yamada H., et al., 1990
External database links:  
DIP:
DIP-9249N
ECOCYC:
EG12193-MONOMER
ECOLIWIKI:
b1000
INTERPRO:
IPR008971
INTERPRO:
IPR036869
INTERPRO:
IPR023859
INTERPRO:
IPR018253
INTERPRO:
IPR002939
INTERPRO:
IPR001623
MODBASE:
P36659
PDB:
3UCS
PDB:
2KQX
PFAM:
PF01556
PFAM:
PF00226
PRIDE:
P36659
PRINTS:
PR00625
PRODB:
PRO_000022250
PROSITE:
PS50076
PROSITE:
PS00636
REFSEQ:
NP_415520
SMART:
SM00271
SMR:
P36659
SWISSMODEL:
P36659
UNIPROT:
P36659


Operon      
Name: cbpAM         
Operon arrangement:
Transcription unit        Promoter
cbpAM
cbpAM
cbpA-cbpM
cbpA-cbpM
cbpA-cbpM


Transcriptional Regulation      
Display Regulation             
Repressed by: Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1312 1063512 reverse nd [RS-EPT-CBR] [17]
  promoter TSS_1313 1063599 reverse nd [RS-EPT-CBR] [17]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Azam TA., Hiraga S., Ishihama A., 2000, Two types of localization of the DNA-binding proteins within the Escherichia coli nucleoid., Genes Cells 5(8):613-26

 [2] Bird JG., Sharma S., Roshwalb SC., Hoskins JR., Wickner S., 2006, Functional analysis of CbpA, a DnaJ homolog and nucleoid-associated DNA-binding protein., J Biol Chem 281(45):34349-56

 [3] Chae C., Sharma S., Hoskins JR., Wickner S., 2004, CbpA, a DnaJ homolog, is a DnaK co-chaperone, and its activity is modulated by CbpM., J Biol Chem 279(32):33147-53

 [4] Chenoweth MR., Trun N., Wickner S., 2007, In vivo modulation of a DnaJ homolog, CbpA, by CbpM., J Bacteriol 189(9):3635-8

 [5] Chenoweth MR., Wickner S., 2008, Complex regulation of the DnaJ homolog CbpA by the global regulators sigmaS and Lrp, by the specific inhibitor CbpM, and by the proteolytic degradation of CbpM., J Bacteriol 190(15):5153-61

 [6] Chintakayala K., Grainger DC., 2011, A conserved acidic amino acid mediates the interaction between modulators and co-chaperones in enterobacteria., J Mol Biol 411(2):313-20

 [7] Chintakayala K., Sellars LE., Singh SS., Shahapure R., Westerlaken I., Meyer AS., Dame RT., Grainger DC., 2015, DNA recognition by Escherichia coli CbpA protein requires a conserved arginine-minor-groove interaction., Nucleic Acids Res 43(4):2282-92

 [8] Chintakayala K., Singh SS., Rossiter AE., Shahapure R., Dame RT., Grainger DC., 2013, E. coli Fis protein insulates the cbpA gene from uncontrolled transcription., PLoS Genet 9(1):e1003152

 [9] Cosgriff S., Chintakayala K., Chim YT., Chen X., Allen S., Lovering AL., Grainger DC., 2010, Dimerization and DNA-dependent aggregation of the Escherichia coli nucleoid protein and chaperone CbpA., Mol Microbiol 77(5):1289-300

 [10] Gur E., Biran D., Shechter N., Genevaux P., Georgopoulos C., Ron EZ., 2004, The Escherichia coli DjlA and CbpA proteins can substitute for DnaJ in DnaK-mediated protein disaggregation., J Bacteriol 186(21):7236-42

 [11] Gur E., Katz C., Ron EZ., 2005, All three J-domain proteins of the Escherichia coli DnaK chaperone machinery are DNA binding proteins., FEBS Lett 579(9):1935-9

 [12] Meyer AS., Grainger DC., 2013, The Escherichia coli Nucleoid in Stationary Phase., Adv Appl Microbiol 83:69-86

 [13] Sarraf NS., Baardsnes J., Cheng J., O'Connor-McCourt M., Cygler M., Ekiel I., 2010, Structural basis of the regulation of the CbpA co-chaperone by its specific modulator CbpM., J Mol Biol 398(1):111-21

 [14] Sarraf NS., Shi R., McDonald L., Baardsnes J., Zhang L., Cygler M., Ekiel I., 2014, Structure of CbpA J-domain bound to the regulatory protein Cbpm explains its specificity and suggests evolutionary link between Cbpm and transcriptional regulators., PLoS One 9(6):e100441

 [15] Ueguchi C., Kakeda M., Yamada H., Mizuno T., 1994, An analogue of the DnaJ molecular chaperone in Escherichia coli., Proc Natl Acad Sci U S A 91(3):1054-8

 [16] Yamada H., Muramatsu S., Mizuno T., 1990, An Escherichia coli protein that preferentially binds to sharply curved DNA., J Biochem 108(3):420-5

 [17] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB