RegulonDB RegulonDB 10.10: Gene Form
   

panZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

livK livJ panZ GcvB panZp7 panZp7 panZp1 panZp1 livKp1 livKp1 livKp2 livKp2 TSS_4060 (cluster) TSS_4060 (cluster) TSS_4059 TSS_4059 TSS_4058 TSS_4058

Gene      
Name: panZ    Texpresso search in the literature
Synonym(s): ECK3443, EG12211, b3459, livL, panM, yhhK
Genome position(nucleotides): 3597984 --> 3598367 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.51
External database links:  
ASAP:
ABE-0011296
ECHOBASE:
EB2125
ECOLIHUB:
yhhK
OU-MICROARRAY:
b3459
STRING:
511145.b3459
COLOMBOS: panZ


Product      
Name: PanD maturation factor
Synonym(s): LivL, PanM, PanZ, YhhK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.506
Isoelectric point: 7.263
Motif(s):
 
Type Positions Sequence
2 -> 125 KLTIIRLEKFSDQDRIDLQKIWPEYSPSSLQVDDNHRIYAARFNERLLAAVRVTLSGTEGALDSLRVREVTRRRGVGQYLLEEVLRNNPGVSCWWMADAGVEDRGVMTAFMQALGFTAQQGGWE
43 -> 48 RFNERL
72 -> 79 TRRRGVGQ
66 -> 68 LRV
45 -> 45 N

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:1905502 - acetyl-CoA binding
GO:0005515 - protein binding
GO:0008080 - N-acetyltransferase activity
biological_process GO:0016485 - protein processing
GO:0015940 - pantothenate biosynthetic process
GO:0043086 - negative regulation of catalytic activity
GO:0031638 - zymogen activation
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IMP] Inferred from mutant phenotype
Reference(s): [1] Adams MD., et al., 1990
[2] Nozaki S., et al., 2012
[3] Stuecker TN., et al., 2015
[4] Wang Q., et al., 2014
External database links:  
ECOCYC:
EG12211-MONOMER
ECOLIWIKI:
b3459
INTERPRO:
IPR040448
INTERPRO:
IPR000182
INTERPRO:
IPR016181
INTERPRO:
IPR032900
PDB:
5LS7
PDB:
4CS0
PDB:
4CRZ
PDB:
4CRY
PDB:
2K5T
PFAM:
PF12568
PRIDE:
P37613
PROSITE:
PS51186
REFSEQ:
NP_417916
SMR:
P37613
UNIPROT:
P37613


Operon      
Name: panZ         
Operon arrangement:
Transcription unit        Promoter
panZ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4058 3596577 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_4059 3597615 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_4060 (cluster) 3597723 reverse nd [RS-EPT-CBR] [5]
  promoter panZp1 3597828 forward nd [ICWHO] [6]
  promoter panZp7 3597958 forward nd [ICWHO], [RS-EPT-CBR] [5], [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Adams MD., Wagner LM., Graddis TJ., Landick R., Antonucci TK., Gibson AL., Oxender DL., 1990, Nucleotide sequence and genetic characterization reveal six essential genes for the LIV-I and LS transport systems of Escherichia coli., J Biol Chem 265(20):11436-43

 [2] Nozaki S., Webb ME., Niki H., 2012, An activator for pyruvoyl-dependent l-aspartate α-decarboxylase is conserved in a small group of the γ-proteobacteria including Escherichia coli., Microbiologyopen 1(3):298-310

 [3] Stuecker TN., Bramhacharya S., Hodge-Hanson KM., Suen G., Escalante-Semerena JC., 2015, Phylogenetic and amino acid conservation analyses of bacterial L-aspartate-α-decarboxylase and of its zymogen-maturation protein reveal a putative interaction domain., BMC Res Notes 8:354

 [4] Wang Q., Yang P., Xian M., Feng L., Wang J., Zhao G., 2014, Metabolic engineering of Escherichia coli for poly(3-hydroxypropionate) production from glycerol and glucose., Biotechnol Lett 36(11):2257-62

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB