RegulonDB RegulonDB 10.9: Gene Form
   

acpT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nikA yhhT acpT NikR FNR terminator anti-terminator anti-anti-terminator terminator anti-terminator anti-anti-terminator TSS_4080 (cluster) TSS_4080 (cluster) TSS_4079 TSS_4079 nikAp1 nikAp1 nikAp2 nikAp2 TSS_4078 TSS_4078

Gene      
Name: acpT    Texpresso search in the literature
Synonym(s): ECK3459, EG12221, b3475, yhhU
Genome position(nucleotides): 3612969 --> 3613556 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.46
External database links:  
ASAP:
ABE-0011351
ECHOBASE:
EB2135
ECOLIHUB:
acpT
OU-MICROARRAY:
b3475
STRING:
511145.b3475
COLOMBOS: acpT


Product      
Name: holo-[acyl carrier protein] synthase 2
Synonym(s): AcpT, ORF195, YhhU, o195
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.768
Isoelectric point: 5.563
Motif(s):
 
Type Positions Sequence
88 -> 172 VGCDIEVIRPRANWRWLANAVFSLGEHAEMDAVHPDQQLEMFWRIWTRKEAIVKQRGGSAWQIVSVDSTYHSSLSVSHCQLENLS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008897 - holo-[acyl-carrier-protein] synthase activity
GO:0000287 - magnesium ion binding
biological_process GO:0006633 - fatty acid biosynthetic process
GO:0018070 - peptidyl-serine phosphopantetheinylation
GO:0019878 - lysine biosynthetic process via aminoadipic acid
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12355N
ECOCYC:
EG12221-MONOMER
ECOLIWIKI:
b3475
INTERPRO:
IPR008278
INTERPRO:
IPR037143
MODBASE:
P37623
PFAM:
PF01648
PRIDE:
P37623
PRODB:
PRO_000022047
REFSEQ:
NP_417932
UNIPROT:
P37623


Operon      
Name: acpT         
Operon arrangement:
Transcription unit        Promoter
acpT


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4078 3612405 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4079 3615136 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4080 (cluster) 3615142 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB