RegulonDB RegulonDB 10.8: Gene Form
   

xylG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

xylG xylH xylR xylF terminator anti-terminator xylRp xylRp

Gene      
Name: xylG    Texpresso search in the literature
Synonym(s): ECK3556, EG12275, b3567
Genome position(nucleotides): 3732201 --> 3733742 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.08
External database links:  
ASAP:
ABE-0011648
CGSC:
33780
ECHOBASE:
EB2184
OU-MICROARRAY:
b3567
PortEco:
xylG
STRING:
511145.b3567
COLOMBOS: xylG


Product      
Name: xylose ABC transporter ATP binding subunit
Synonym(s): XylG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 56.47
Isoelectric point: 6.122
Motif(s):
 
Type Positions Sequence
278 -> 433 NDVSFSLKRGEILGIAGLVGAGRTETIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIAQGIAMVPEDRKRDGIVPVMAVGKNITLAALNKFTGGISQLDDAAEQKCILESIQQLKVKTSSPDLAIGRLSGGNQQKAILARCLLLNPRILILDEPT
37 -> 44 GENGSGKS
259 -> 505 LRIEHLTAWHPVNRHIKRVNDVSFSLKRGEILGIAGLVGAGRTETIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIAQGIAMVPEDRKRDGIVPVMAVGKNITLAALNKFTGGISQLDDAAEQKCILESIQQLKVKTSSPDLAIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGAKYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHEGKLKANLINHNLTQEQVMEAALRSE
21 -> 171 DNVCLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYEGEIIFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNEITHNGIMDYDLMTLRCQKLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILDEPTA
5 -> 242 LEMKNITKTFGSVKAIDNVCLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYEGEIIFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNEITHNGIMDYDLMTLRCQKLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILDEPTASLTEQETSILLDIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAAGMSEDDIITMMVGRE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015148 - D-xylose transmembrane transporter activity
GO:0015614 - ATPase-coupled D-xylose transmembrane transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0042732 - D-xylose metabolic process
GO:0015752 - D-ribose transmembrane transport
GO:0015753 - D-xylose transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
XYLG-MONOMER
ECOLIWIKI:
b3567
INTERPRO:
IPR003439
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR013455
INTERPRO:
IPR003593
MODBASE:
P37388
PFAM:
PF00005
PRIDE:
P37388
PRODB:
PRO_000024243
PROSITE:
PS51280
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_418024
SMART:
SM00382
SMR:
P37388
UNIPROT:
P37388


Operon      
Name: xylFGHR         
Operon arrangement:
Transcription unit        Promoter
xylFGHR
xylR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, XylR
Repressed by: Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB