RegulonDB RegulonDB 10.9: Gene Form
   

sgbH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lyxK yiaO sgbU sgbE sgbH

Gene      
Name: sgbH    Texpresso search in the literature
Synonym(s): ECK3570, EG12285, b3581, yiaQ
Genome position(nucleotides): 3748577 --> 3749239 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
59.43
External database links:  
ASAP:
ABE-0011698
ECHOBASE:
EB2193
ECOLIHUB:
sgbH
OU-MICROARRAY:
b3581
STRING:
511145.b3581
COLOMBOS: sgbH


Product      
Name: 3-keto-L-gulonate-6-phosphate decarboxylase SgbH
Synonym(s): SgbH, YiaQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.445
Isoelectric point: 5.296
Motif(s):
 
Type Positions Sequence
5 -> 204 LLQLALDHSSLEAAQRDVTLLKDSVDIVEAGTILCLNEGLGAVKALREQCPDKIIVADWKVADAGETLAQQAFGAGANWMTIICAAPLATVEKGHAMAQRCGGEIQIELFGNWTLDDARDWHRIGVRQAIYHRGRDAQASGQQWGEADLARMKALSDIGLELSITGGITPADLPLFKDIRVKAFIAGRALAGAANPAQVA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016831 - carboxy-lyase activity
GO:0004590 - orotidine-5'-phosphate decarboxylase activity
GO:0033982 - 3-dehydro-L-gulonate-6-phosphate decarboxylase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0016052 - carbohydrate catabolic process
GO:0006207 - 'de novo' pyrimidine nucleobase biosynthetic process
GO:0019854 - L-ascorbic acid catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10873N
ECOCYC:
EG12285-MONOMER
ECOLIWIKI:
b3581
INTERPRO:
IPR011060
INTERPRO:
IPR041710
INTERPRO:
IPR013785
INTERPRO:
IPR001754
MODBASE:
P37678
PFAM:
PF00215
PRIDE:
P37678
PRODB:
PRO_000023944
REFSEQ:
NP_418038
SMART:
SM00934
SMR:
P37678
SWISSMODEL:
P37678
UNIPROT:
P37678


Operon      
Name: yiaKLMNO-lyxK-sgbHUE         
Operon arrangement:
Transcription unit        Promoter
yiaKLMNO-lyx-sgbHUE
yiaKLMNO-lyx-sgbHUE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IHF
Repressed by: YiaJ
Undetermined regulation CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB