RegulonDB RegulonDB 10.9: Gene Form
   

sgbU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lyxK sgbU sgbE sgbH ysaC

Gene      
Name: sgbU    Texpresso search in the literature
Synonym(s): ECK3571, EG12286, b3582, yiaR
Genome position(nucleotides): 3749232 --> 3750092 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.75
Reference(s): [1] Ibanez E., et al., 2000
External database links:  
ASAP:
ABE-0011700
ECHOBASE:
EB2194
ECOLIHUB:
sgbU
OU-MICROARRAY:
b3582
STRING:
511145.b3582
COLOMBOS: sgbU


Product      
Name: putative L-xylulose 5-phosphate 3-epimerase
Synonym(s): SgbU, YiaR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.455
Isoelectric point: 5.474
Motif(s):
 
Type Positions Sequence
25 -> 276 LAKSCGFDFVEMSVDETDERLSRLDWSAAQRTSLVAAMIETGVGIPSMCLSAHRRFPFGSRDEAVRERAREIMSKAIRLARDLGIRTIQLAGYDVYYEDHDEGTRQRFAEGLAWAVEQAAASQVMLAVEIMDTAFMNSISKWKKWDEMLASPWFTVYPDVGNLSAWGNDVPAELKLGIDRIAAIHLKDTQPVTGQSPGQFRDVPFGEGCVDFVGIFKTLHKLNYRGSFLIEMWTEKAKEPVLEIIQARRWIE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0016853 - isomerase activity
GO:0016861 - intramolecular oxidoreductase activity, interconverting aldoses and ketoses
GO:0008270 - zinc ion binding
GO:0034015 - L-ribulose-5-phosphate 3-epimerase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006281 - DNA repair
GO:0019324 - L-lyxose metabolic process
GO:0019852 - L-ascorbic acid metabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12286-MONOMER
ECOLIWIKI:
b3582
INTERPRO:
IPR004560
INTERPRO:
IPR036237
INTERPRO:
IPR013022
INTERPRO:
IPR001719
MODBASE:
P37679
PFAM:
PF01261
PRIDE:
P37679
REFSEQ:
NP_418039
SMR:
P37679
UNIPROT:
P37679


Operon      
Name: yiaKLMNO-lyxK-sgbHUE         
Operon arrangement:
Transcription unit        Promoter
yiaKLMNO-lyx-sgbHUE
yiaKLMNO-lyx-sgbHUE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IHF
Repressed by: YiaJ
Undetermined regulation CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Ibanez E., Gimenez R., Pedraza T., Baldoma L., Aguilar J., Badia J., 2000, Role of the yiaR and yiaS genes of Escherichia coli in metabolism of endogenously formed L-xylulose., J Bacteriol 182(16):4625-7


RegulonDB