RegulonDB RegulonDB 10.9: Gene Form
   

yiaU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yiaV yiaU yiaT yiaW anti-terminator terminator yiaUp8 yiaUp8 yiaUp9 yiaUp9 yiaTp3 yiaTp3 yiaTp6 yiaTp6 yiaTp8 yiaTp8 yiaUp11 yiaUp11 yiaTp4 yiaTp4

Gene      
Name: yiaU    Texpresso search in the literature
Synonym(s): ECK3574, EG12289, b3585
Genome position(nucleotides): 3751992 --> 3752966 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.69
External database links:  
ASAP:
ABE-0011710
ECHOBASE:
EB2197
ECOLIHUB:
yiaU
OU-MICROARRAY:
b3585
STRING:
511145.b3585
COLOMBOS: yiaU


Product      
Name: putative LysR-type DNA-binding transcriptional regulator YiaU
Synonym(s): YiaU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.274
Isoelectric point: 5.652
Motif(s):
 
Type Positions Sequence
23 -> 42 ISHAATVLGIAQANVSKYLA
6 -> 63 LKYRELKIISVIAASENISHAATVLGIAQANVSKYLADFESKVGLKVFDRTTRQLMLT
9 -> 66 RELKIISVIAASENISHAATVLGIAQANVSKYLADFESKVGLKVFDRTTRQLMLTPFG
146 -> 303 DDCDVLISYAPPKDESLVASFITQYAVTAYASQRYLEKHPISRPDELEHHSCILIDSMMIDDANIWRFNVAGSKEVRDYRVKGNYVCDNTQSALELARNHLGIVFAPDKSVQSDLQDGTLVPCFQQPYEWWLDLVAIFRKREYQPWRVQYVLDEMLRE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-12411N
ECOCYC:
EG12289-MONOMER
ECOLIWIKI:
b3585
INTERPRO:
IPR005119
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR000847
MODBASE:
P37682
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P37682
PROSITE:
PS50931
REFSEQ:
NP_418042
SMR:
P37682
UNIPROT:
P37682


Operon      
Name: yiaU         
Operon arrangement:
Transcription unit        Promoter
yiaU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yiaTp4 3751875 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yiaUp11 3751896 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yiaTp8 3751905 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yiaTp6 3751960 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yiaTp3 3751962 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yiaUp9 3751975 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yiaUp8 3751986 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB