RegulonDB RegulonDB 10.9: Gene Form
   

grxC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

secB yibN grxC CRP terminator grxCp2 grxCp2 TSS_4191 TSS_4191 TSS_4190 TSS_4190 TSS_4189 TSS_4189 TSS_4188 TSS_4188 secBp secBp TSS_4186 TSS_4186 gpsAp5 gpsAp5 gpsAp8 gpsAp8

Gene      
Name: grxC    Texpresso search in the literature
Synonym(s): ECK3600, EG12294, b3610, yibM
Genome position(nucleotides): 3784191 <-- 3784442 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.38
External database links:  
ASAP:
ABE-0011801
ECHOBASE:
EB2202
ECOLIHUB:
grxC
OU-MICROARRAY:
b3610
STRING:
511145.b3610
COLOMBOS: grxC


Product      
Name: glutaredoxin 3
Synonym(s): GrxC, YibM, reduced glutaredoxin 3
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.137
Isoelectric point: 7.351
Motif(s):
 
Type Positions Sequence
2 -> 83 ANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDPLLK
4 -> 63 VEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDAQHI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.2 - thioredoxin, glutaredoxin
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0009055 - electron transfer activity
GO:0004362 - glutathione-disulfide reductase activity
GO:0015035 - protein disulfide oxidoreductase activity
GO:0043295 - glutathione binding
biological_process GO:0009263 - deoxyribonucleotide biosynthetic process
GO:0045454 - cell redox homeostasis
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
GO:0034599 - cellular response to oxidative stress
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
ECOCYC:
GRXC-MONOMER
ECOLIWIKI:
b3610
INTERPRO:
IPR036249
INTERPRO:
IPR014025
INTERPRO:
IPR011900
INTERPRO:
IPR011767
INTERPRO:
IPR002109
PDB:
1UQ8
PDB:
1UQ9
PDB:
1UQI
PDB:
1UQJ
PDB:
1UQK
PDB:
1ILB
PDB:
1FOV
PDB:
1UQM
PDB:
1UQO
PDB:
1UQP
PDB:
1UQQ
PDB:
1UQL
PDB:
3GRX
PFAM:
PF00462
PRIDE:
P0AC62
PRINTS:
PR00160
PROSITE:
PS51354
PROSITE:
PS00195
REFSEQ:
NP_418067
SMR:
P0AC62
UNIPROT:
P0AC62


Operon      
Name: yibN-grxC-secB-gpsA         
Operon arrangement:
Transcription unit        Promoter
secB-gpsA
yibN-grxC-secB-gpsA
grxC
yibN


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter gpsAp8 3783681 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter gpsAp5 3783810 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_4186 3784160 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4188 3784234 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4189 3784239 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4190 3784506 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4191 3784513 reverse nd [RS-EPT-CBR] [2]
  promoter grxCp2 3784576 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB