RegulonDB RegulonDB 10.9: Gene Form
   

gpmM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gpmM envC yibN Cra TSS_4202 TSS_4202 TSS_4201 TSS_4201 TSS_4200 TSS_4200 TSS_4199 TSS_4199 TSS_4198 TSS_4198 TSS_4197 (cluster) TSS_4197 (cluster) TSS_4196 (cluster) TSS_4196 (cluster) gpmMp gpmMp TSS_4195 (cluster) TSS_4195 (cluster) TSS_4194 (cluster) TSS_4194 (cluster) yibNp yibNp gpmMp2 gpmMp2 TSS_4193 TSS_4193 yibNp7 yibNp7 TSS_4192 (cluster) TSS_4192 (cluster)

Gene      
Name: gpmM    Texpresso search in the literature
Synonym(s): ECK3602, EG12296, b3612, gpmC, gpmI, pgmI, yibO
Genome position(nucleotides): 3785260 --> 3786804 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.46
External database links:  
ASAP:
ABE-0011818
ECHOBASE:
EB2204
ECOLIHUB:
gpmM
OU-MICROARRAY:
b3612
STRING:
511145.b3612
COLOMBOS: gpmM


Product      
Name: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
Synonym(s): GpmC, GpmI, GpmM, PgmI, YibO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 56.194
Isoelectric point: 4.927
Motif(s):
 
Type Positions Sequence
155 -> 156 RD
263 -> 266 RADR
6 -> 500 KPMVLVILDGYGYREEQQDNAIFSAKTPVMDALWANRPHTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKDRAFFANPVLTGAVDKAKNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQPDAAMEDGDALIFMNFRADRAREITRAFVNADFDGFARKKVVNVDFVMLTEYAADIKTAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYVGDKNVKAVEGGKLSDIAPTMLSLMGME
86 -> 299 VEIKDRAFFANPVLTGAVDKAKNAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATVIRAEGQPDAAMEDGDALIFMNFRADRAREITRAFVNADFDGFARKKVVNVDFVMLTEYA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0004619 - phosphoglycerate mutase activity
GO:0030145 - manganese ion binding
GO:0046537 - 2,3-bisphosphoglycerate-independent phosphoglycerate mutase activity
biological_process GO:0044262 - cellular carbohydrate metabolic process
GO:0006007 - glucose catabolic process
GO:0006096 - glycolytic process
GO:0006979 - response to oxidative stress
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12425N
ECOCYC:
PGMI-MONOMER
ECOLIWIKI:
b3612
INTERPRO:
IPR005995
INTERPRO:
IPR036646
INTERPRO:
IPR017850
INTERPRO:
IPR011258
INTERPRO:
IPR006124
MODBASE:
P37689
PANTHER:
PTHR31637
PFAM:
PF01676
PFAM:
PF06415
PRIDE:
P37689
PRODB:
PRO_000022831
REFSEQ:
NP_418069
SMR:
P37689
SWISSMODEL:
P37689
UNIPROT:
P37689


Operon      
Name: gpmM-envC-yibQ         
Operon arrangement:
Transcription unit        Promoter
gpmM-envC-yibQ
gpmM-envC-yibQ


Transcriptional Regulation      
Display Regulation             
Repressed by: Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4192 (cluster) 3785055 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter yibNp7 3785056 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4193 3785186 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4194 (cluster) 3785206 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4195 (cluster) 3785226 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4196 (cluster) 3785237 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4197 (cluster) 3785244 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4198 3785340 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4199 3785763 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4200 3786671 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4201 3786814 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4202 3786964 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB