RegulonDB RegulonDB 10.8: Gene Form
   

yadN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yadV yadN folK pcnB yadNp7 yadNp7 yadNp8 yadNp8 yadNp1 yadNp1 yadVp1 yadVp1 yadVp2 yadVp2 yadVp3 yadVp3 htrEp1 htrEp1

Gene      
Name: yadN    Texpresso search in the literature
Synonym(s): ECK0140, EG12328, b0141
Genome position(nucleotides): 156299 <-- 156883 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.79
External database links:  
ASAP:
ABE-0000487
ECHOBASE:
EB2232
OU-MICROARRAY:
b0141
PortEco:
yadN
STRING:
511145.b0141
COLOMBOS: yadN


Product      
Name: putative fimbrial protein YadN
Synonym(s): YadN
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 20.118
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
35 -> 194 LVVDNTCETRVDGGNKDGLILLQTATVGEIDAGVLNDTVGAKAKPFSITVDCSKANPNPGSTAKMTFGSVFFGNSKGTLNNDMSINNPSDGVNIALHNIDGSTIKQVQINNPGDVYTKALDATTKSAVYDFKASYVRAVADQTATAGYVKTNTAYTITYQ
1 -> 23 MSKKLGFALSGLMLAMVAGTASA
24 -> 194 DMDGGQLNISGLVVDNTCETRVDGGNKDGLILLQTATVGEIDAGVLNDTVGAKAKPFSITVDCSKANPNPGSTAKMTFGSVFFGNSKGTLNNDMSINNPSDGVNIALHNIDGSTIKQVQINNPGDVYTKALDATTKSAVYDFKASYVRAVADQTATAGYVKTNTAYTITYQ

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Larsonneur F., et al., 2016
[4] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
EG12328-MONOMER
ECOLIWIKI:
b0141
INTERPRO:
IPR000259
INTERPRO:
IPR036937
INTERPRO:
IPR008966
MODBASE:
P37050
PFAM:
PF00419
PRIDE:
P37050
REFSEQ:
NP_414683
UNIPROT:
P37050


Operon      
Name: yadN         
Operon arrangement:
Transcription unit        Promoter
yadN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter htrEp1 155518 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter yadNp1 156984 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter yadNp8 157031 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter yadNp7 157055 reverse Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Larsonneur F., Martin FA., Mallet A., Martinez-Gil M., Semetey V., Ghigo JM., Beloin C., 2016, Functional analysis of Escherichia coli Yad fimbriae reveals their potential role in environmental persistence., Environ Microbiol 18(12):5228-5248

 [4] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB