RegulonDB RegulonDB 10.9: Gene Form
   

ettA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

slt ettA nadR CpxR sltp7 sltp7 TSS_5178 TSS_5178 yjjKp11 yjjKp11 TSS_5177 (cluster) TSS_5177 (cluster) TSS_5176 TSS_5176 TSS_5175 TSS_5175 TSS_5174 TSS_5174

Gene      
Name: ettA    Texpresso search in the literature
Synonym(s): ECK4383, EG12343, b4391, yjjK
Genome position(nucleotides): 4628855 <-- 4630522 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.74
External database links:  
ASAP:
ABE-0014400
ECHOBASE:
EB2247
ECOLIHUB:
yjjK
OU-MICROARRAY:
b4391
STRING:
511145.b4391
COLOMBOS: ettA


Product      
Name: energy-dependent translational throttle protein EttA
Synonym(s): EttA, YjjK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 62.443
Isoelectric point: 5.296
Motif(s):
 
Type Positions Sequence
230 -> 306 LELDRGEGIPWEGNYSSWLEQKDQRLAQEASQEAARRKSIEKELEWVRQGTKGRQSKGKARLARFEELNSTEYQKRN
470 -> 470 E
324 -> 550 LEVSNLRKSYGDRLLIDDLSFSIPKGAIVGIIGPNGAGKSTLFRMISGQEQPDSGTITLGETVKLASVDQFRDSMDNSKTVWEEVSGGLDIMKIGNTEMPSRAYVGRFNFKGVDQGKRVGELSGGERGRLHLAKLLQVGGNMLLLDEPTNDLDIETLRALENALLEFPGCAMVISHDRWFLDRIATHILDYQDEGKVEFFEGNFTEYEEYKKRTLGADALEPKRIKY
356 -> 363 GPNGAGKS
39 -> 46 GLNGAGKS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005886 - plasma membrane
molecular_function GO:0016787 - hydrolase activity
GO:0016887 - ATPase activity
GO:0043022 - ribosome binding
GO:0003723 - RNA binding
GO:0000049 - tRNA binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0019843 - rRNA binding
biological_process GO:0006412 - translation
GO:0006417 - regulation of translation
GO:0045900 - negative regulation of translational elongation
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IMP] Inferred from mutant phenotype
Reference(s): [1] Boel G., et al., 2014
[2] Chen B., et al., 2014
[3] Linton KJ., et al., 1998
[4] Murina V., et al., 2019
[5] Paradis-Bleau C., et al., 2014
[6] Xu Y., et al., 2017
External database links:  
DIP:
DIP-48138N
ECOCYC:
YJJK-MONOMER
ECOLIWIKI:
b4391
INTERPRO:
IPR027417
INTERPRO:
IPR032781
INTERPRO:
IPR022374
INTERPRO:
IPR017871
INTERPRO:
IPR003593
INTERPRO:
IPR003439
PANTHER:
PTHR43858
PDB:
3J5S
PDB:
4FIN
PFAM:
PF12848
PFAM:
PF00005
PRIDE:
P0A9W3
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_418808
SMART:
SM00382
SMR:
P0A9W3
UNIPROT:
P0A9W3


Operon      
Name: ettA         
Operon arrangement:
Transcription unit        Promoter
yjjK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5174 4627723 forward nd [RS-EPT-CBR] [7]
  promoter TSS_5175 4628076 forward nd [RS-EPT-CBR] [7]
  promoter TSS_5176 4630555 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_5177 (cluster) 4630564 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter yjjKp11 4630566 reverse Similarity to the consensus
Read more >
[ICWHO] [8]
  promoter TSS_5178 4630567 reverse nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Boel G., Smith PC., Ning W., Englander MT., Chen B., Hashem Y., Testa AJ., Fischer JJ., Wieden HJ., Frank J., Gonzalez RL., Hunt JF., 2014, The ABC-F protein EttA gates ribosome entry into the translation elongation cycle., Nat Struct Mol Biol 21(2):143-51

 [2] Chen B., Boel G., Hashem Y., Ning W., Fei J., Wang C., Gonzalez RL., Hunt JF., Frank J., 2014, EttA regulates translation by binding the ribosomal E site and restricting ribosome-tRNA dynamics., Nat Struct Mol Biol 21(2):152-9

 [3] Linton KJ., Higgins CF., 1998, The Escherichia coli ATP-binding cassette (ABC) proteins., Mol Microbiol 28(1):5-13

 [4] Murina V., Kasari M., Takada H., Hinnu M., Saha CK., Grimshaw JW., Seki T., Reith M., Putrins M., Tenson T., Strahl H., Hauryliuk V., Atkinson GC., 2019, ABCF ATPases Involved in Protein Synthesis, Ribosome Assembly and Antibiotic Resistance: Structural and Functional Diversification across the Tree of Life., J Mol Biol 431(18):3568-3590

 [5] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [6] Xu Y., Liu Y., Li F., Cao G., Zheng P., Sun J., Wen J., Zhang D., 2017, Identification of a new gene yecC involved in threonine export in Escherichia coli., FEMS Microbiol Lett 364(17)

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [8] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB