RegulonDB RegulonDB 10.8: Gene Form
   

ssuB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pepN ssuD ssuC ssuB ssuA CRP ssuBp3 ssuBp3 TSS_1246 TSS_1246 TSS_1245 (cluster) TSS_1245 (cluster)

Gene      
Name: ssuB    Texpresso search in the literature
Synonym(s): ECK0924, EG12358, b0933, ycbE
Genome position(nucleotides): 993277 <-- 994044 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.6
External database links:  
ASAP:
ABE-0003173
ECHOBASE:
EB2261
OU-MICROARRAY:
b0933
PortEco:
ssuB
STRING:
511145.b0933
COLOMBOS: ssuB


Product      
Name: aliphatic sulfonate ABC transporter ATP binding subunit
Synonym(s): SsuB, YcbE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 27.738
Isoelectric point: 7.102
Motif(s):
 
Type Positions Sequence
44 -> 51 GRSGGGKS
27 -> 160 LNQLDLHIPAGQFVAVVGRSGGGKSTLLRLLAGLETPTAGDVLAGTTPLAEIQEDTRMMFQDARLLPWKSVIDNVGLGLKGQWRDAARRALAAVGLENRAGEWPAALSGGQKQRVALARALIHRPGLLLLDEPL
161 -> 165 GALDA
236 -> 237 EV
153 -> 160 LLLLDEPL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008509 - anion transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
GO:0042959 - alkanesulfonate transmembrane transporter activity
biological_process GO:0006790 - sulfur compound metabolic process
GO:0006820 - anion transport
GO:0055085 - transmembrane transport
GO:0042918 - alkanesulfonate transport
GO:0098656 - anion transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YCBE-MONOMER
ECOLIWIKI:
b0933
INTERPRO:
IPR017871
INTERPRO:
IPR017875
INTERPRO:
IPR027417
INTERPRO:
IPR003439
INTERPRO:
IPR003593
MODBASE:
P0AAI1
PANTHER:
PTHR42788:SF7
PFAM:
PF00005
PRIDE:
P0AAI1
PRODB:
PRO_000023995
PROSITE:
PS00211
PROSITE:
PS51291
PROSITE:
PS50893
REFSEQ:
NP_415453
SMART:
SM00382
SMR:
P0AAI1
SWISSMODEL:
P0AAI1
UNIPROT:
P0AAI1


Operon      
Name: ssuEADCB         
Operon arrangement:
Transcription unit        Promoter
ssuEADCB


Transcriptional Regulation      
Display Regulation             
Activated by: Cbl, FNR, IHF
Repressed by: CysB, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1245 (cluster) 991200 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1246 991492 forward nd [RS-EPT-CBR] [1]
  promoter ssuBp3 994141 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB