RegulonDB RegulonDB 10.8: Gene Form
   

norW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hypF norR norV norW C0664 gutQ IHF IHF NarP NarL NarP NarL NorR NorR NorR FNR NsrR terminator norVp norVp norRp norRp

Gene      
Name: norW    Texpresso search in the literature
Synonym(s): ECK2706, EG12450, b2711, ygaL, ygbD
Genome position(nucleotides): 2833912 --> 2835045 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.06
External database links:  
ASAP:
ABE-0008912
ECHOBASE:
EB2344
OU-MICROARRAY:
b2711
PortEco:
norW
STRING:
511145.b2711
COLOMBOS: norW


Product      
Name: NADH:flavorubredoxin reductase
Synonym(s): NorW, YgaL, YgbD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.404
Isoelectric point: 6.376
Motif(s):
 
Type Positions Sequence
264 -> 264 S
5 -> 278 IVIIGSGFAARQLVKNIRKQDATIPLTLIAADSMDEYNKPDLSHVISQGQRADDLTRQTAGEFAEQFNLHLFPQTWVTDIDAEARVVKSQNNQWQYDKLVLATGASAFVPPVPGRELMLTLNSQQEYRACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASLMPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGIQATLDRQRNIEVDAVIAATGLRPETALARRAGLTINRGVCVDSYLQTSNTDIYALGDCAEIN
305 -> 375 PLKLPAMLVKIKTPELPLHLAGETQRQDLRWQINTERQGMVARGVDDADQLRAFVVSEDRMKEAFGLLKTL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.3 - electron carriers
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0016731 - oxidoreductase activity, acting on iron-sulfur proteins as donors, NAD or NADP as acceptor
GO:0015044 - rubredoxin-NAD+ reductase activity
biological_process GO:0055114 - oxidation-reduction process
GO:0046210 - nitric oxide catabolic process
GO:0071732 - cellular response to nitric oxide
Note(s): Note(s): ...[more].
Reference(s): [1] Baptista JM., et al., 2012
[2] Proudfoot M., et al., 2008
[3] Vine CE., et al., 2011
[4] da Costa PN., et al., 2003
External database links:  
ECOCYC:
EG12450-MONOMER
ECOLIWIKI:
b2711
INTERPRO:
IPR036188
INTERPRO:
IPR041364
INTERPRO:
IPR023961
INTERPRO:
IPR023753
MODBASE:
P37596
PFAM:
PF07992
PFAM:
PF18113
PRIDE:
P37596
PRINTS:
PR00368
PRODB:
PRO_000023400
REFSEQ:
NP_417191
SMR:
P37596
UNIPROT:
P37596


Operon      
Name: norVW         
Operon arrangement:
Transcription unit        Promoter
norVW


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, NorR
Repressed by: FNR, IHF, NarL, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Baptista JM., Justino MC., Melo AM., Teixeira M., Saraiva LM., 2012, Oxidative stress modulates the nitric oxide defense promoted by Escherichia coli flavorubredoxin., J Bacteriol 194(14):3611-7

 [2] Proudfoot M., Sanders SA., Singer A., Zhang R., Brown G., Binkowski A., Xu L., Lukin JA., Murzin AG., Joachimiak A., Arrowsmith CH., Edwards AM., Savchenko AV., Yakunin AF., 2008, Biochemical and structural characterization of a novel family of cystathionine beta-synthase domain proteins fused to a Zn ribbon-like domain., J Mol Biol 375(1):301-15

 [3] Vine CE., Cole JA., 2011, Nitrosative stress in Escherichia coli: reduction of nitric oxide., Biochem Soc Trans 39(1):213-5

 [4] da Costa PN., Teixeira M., Saraiva LM., 2003, Regulation of the flavorubredoxin nitric oxide reductase gene in Escherichia coli: nitrate repression, nitrite induction, and possible post-transcription control., FEMS Microbiol Lett 218(2):385-93


RegulonDB