RegulonDB RegulonDB 10.9: Gene Form
   

adiC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eptA adiC adiY basR adiCp7 adiCp7

Gene      
Name: adiC    Texpresso search in the literature
Synonym(s): ECK4108, EG12462, b4115, yjdD, yjdE
Genome position(nucleotides): 4335694 <-- 4337031 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.74
External database links:  
ASAP:
ABE-0013473
ECHOBASE:
EB2355
ECOLIHUB:
adiC
OU-MICROARRAY:
b4115
STRING:
511145.b4115
COLOMBOS: adiC


Product      
Name: arginine:agmatine antiporter
Synonym(s): AdiC, YjdD, YjdE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 46.843
Isoelectric point: 9.107
Motif(s):
 
Type Positions Sequence
356 -> 376 VSVIFTLVPYLYTCAALLLLG
386 -> 406 AYLAVTTIAFLYCIWAVVGSG
12 -> 403 LIPVTLMVSGNIMGSGVFLLPANLASTGGIAIYGWLVTIIGALGLSMVYAKMSFLDPSPGGSYAYARRCFGPFLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFPILKDPLVLTITCVVVLWIFVLLNIVGPKMITRVQAVATVLALIPIVGIAVFGWFWFRGETYMAAWNVSGLGTFGAIQSTLNVTLWSFIGVESASVAAGVVKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGDTAGAIVSFCAAAGCLGSLGGWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGLIIVGILMTIFQLSSISPNATKEFGLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKARPAYLAVTTIAFLYCIWAVV
99 -> 119 IGNIAMVVIGVGYLSYFFPIL
153 -> 173 VATVLALIPIVGIAVFGWFWF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015297 - antiporter activity
GO:0022857 - transmembrane transporter activity
GO:0015181 - arginine transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0051454 - intracellular pH elevation
GO:0055085 - transmembrane transport
GO:0003333 - amino acid transmembrane transport
GO:1903826 - arginine transmembrane transport
Reference(s): [1] Gong S., et al., 2003
[2] Iyer R., et al., 2003
External database links:  
DIP:
DIP-59619N
ECOCYC:
YJDE-MONOMER
ECOLIWIKI:
b4115
INTERPRO:
IPR002293
PDB:
3OB6
PDB:
5J4N
PDB:
5J4I
PFAM:
PF13520
PRIDE:
P60061
PRODB:
PRO_000022059
REFSEQ:
NP_418539
SMR:
P60061
UNIPROT:
P60061


Operon      
Name: adiC         
Operon arrangement:
Transcription unit        Promoter
adiC


Transcriptional Regulation      
Display Regulation             
Activated by: GadE-RcsB, PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Gong S., Richard H., Foster JW., 2003, YjdE (AdiC) is the arginine:agmatine antiporter essential for arginine-dependent acid resistance in Escherichia coli., J Bacteriol 185(15):4402-9

 [2] Iyer R., Williams C., Miller C., 2003, Arginine-agmatine antiporter in extreme acid resistance in Escherichia coli., J Bacteriol 185(22):6556-61


RegulonDB