RegulonDB RegulonDB 10.9: Gene Form
   

ytfQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ytfR ytfQ ppa anti-anti-terminator anti-terminator terminator ytfQp6 ytfQp6 ppap ppap TSS_5080 (cluster) TSS_5080 (cluster)

Gene      
Name: ytfQ    Texpresso search in the literature
Synonym(s): ECK4223, EG12517, b4227
Genome position(nucleotides): 4449962 --> 4450918 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.84
External database links:  
ASAP:
ABE-0013829
ECHOBASE:
EB2409
ECOLIHUB:
ytfQ
OU-MICROARRAY:
b4227
STRING:
511145.b4227
COLOMBOS: ytfQ


Product      
Name: galactofuranose ABC transporter periplasmic binding protein
Synonym(s): YtfQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 34.345
Isoelectric point: 7.263
Motif(s):
 
Type Positions Sequence
26 -> 274 VGFSQVGSESGWRAAETNVAKSEAEKRGITLKIADGQQKQENQIKAVRSFVAQGVDAIFIAPVVATGWEPVLKEAKDAEIPVFLLDRSIDVKDKSLYMTTVTADNILEGKLIGDWLVKEVNGKPCNVVELQGTVGASVAIDRKKGFAEAIKNAPNIKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAGLKPGKDILTGSIDGVPDIYKAMMDGEANASVELTPNMAG
130 -> 268 NILEGKLIGDWLVKEVNGKPCNVVELQGTVGASVAIDRKKGFAEAIKNAPNIKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAGLKPGKDILTGSIDGVPDIYKAMMDGEANASVEL
297 -> 313 KSTLYLPDTAKEELEKK
34 -> 38 ESGWR
23 -> 129 PLTVGFSQVGSESGWRAAETNVAKSEAEKRGITLKIADGQQKQENQIKAVRSFVAQGVDAIFIAPVVATGWEPVLKEAKDAEIPVFLLDRSIDVKDKSLYMTTVTAD

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005534 - galactose binding
biological_process GO:0008643 - carbohydrate transport
GO:0015757 - galactose transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YTFQ-MONOMER
ECOLIWIKI:
b4227
INTERPRO:
IPR028082
INTERPRO:
IPR033893
INTERPRO:
IPR025997
MODBASE:
P39325
PDB:
2VK2
PFAM:
PF13407
PRIDE:
P39325
REFSEQ:
NP_418648
SMR:
P39325
UNIPROT:
P39325


Operon      
Name: ytfQRT-yjfF         
Operon arrangement:
Transcription unit        Promoter
ytfQRT-yjfF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5080 (cluster) 4449647 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter ytfQp6 4449817 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB