RegulonDB RegulonDB 10.10: Gene Form
   

opgB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

opgB lgoD yjjA terminator opgBp7 opgBp7 TSS_5156 TSS_5156 TSS_5155 TSS_5155

Gene      
Name: opgB    Texpresso search in the literature
Synonym(s): ECK4349, EG12591, b4359, mdoB, yjjO
Genome position(nucleotides): 4597150 <-- 4599441 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.01
External database links:  
ASAP:
ABE-0014297
CGSC:
18169
ECHOBASE:
EB2476
ECOLIHUB:
mdoB
OU-MICROARRAY:
b4359
STRING:
511145.b4359
COLOMBOS: opgB


Product      
Name: phosphoglycerol transferase I
Synonym(s): MdoB, OpgB, YjjO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 85.494
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
108 -> 128 FGYSLLALLLALGSVDASPAF
26 -> 46 WWFAATLTVLGLFVVLNITLF
77 -> 97 ILPGIGIVLGLTAVFGALGWI
1 -> 21 MSELLSFALFLASVLIYAWKA
163 -> 446 NLVYIYGESLERTYFDNEAFPDLTPELGALKNEGLDFSHTQQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFFPQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRNDWGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQSFSAVSCSQENIATFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRGDKPQQETLAVKRNTMDNGATVLDILG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.1 - phospholipid
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.6 - osmoregulated periplasmic glucan
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0004065 - arylsulfatase activity
GO:0008484 - sulfuric ester hydrolase activity
GO:0008960 - phosphatidylglycerol-membrane-oligosaccharide glycerophosphotransferase activity
biological_process GO:0009250 - glucan biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10175N
ECOCYC:
PGLYCEROLTRANSI-MONOMER
ECOLIWIKI:
b4359
INTERPRO:
IPR020881
INTERPRO:
IPR017850
INTERPRO:
IPR000917
MODBASE:
P39401
PFAM:
PF00884
PRIDE:
P39401
PRODB:
PRO_000023177
REFSEQ:
NP_418779
SMR:
P39401
UNIPROT:
P39401


Operon      
Name: opgB         
Operon arrangement:
Transcription unit        Promoter
opgB


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5155 4597417 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_5156 4599493 reverse nd [RS-EPT-CBR] [1]
  promoter opgBp7 4599494 reverse nd [ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB