RegulonDB RegulonDB 10.9: Gene Form
   

dppF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhjV dppF dppD dppC TSS_4144 (cluster) TSS_4144 (cluster) TSS_4143 TSS_4143 TSS_4142 TSS_4142 TSS_4141 TSS_4141 TSS_4140 TSS_4140

Gene      
Name: dppF    Texpresso search in the literature
Synonym(s): ECK3527, EG12628, b3540, dppE
Genome position(nucleotides): 3701864 <-- 3702868 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.12
External database links:  
ASAP:
ABE-0011564
CGSC:
33752
ECHOBASE:
EB2512
ECOLIHUB:
dppF
OU-MICROARRAY:
b3540
STRING:
511145.b3540
COLOMBOS: dppF


Product      
Name: dipeptide ABC transporter ATP binding subunit DppF
Synonym(s): DppE, DppF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 37.56
Isoelectric point: 9.121
Motif(s):
 
Type Positions Sequence
181 -> 189 DVVIADEPV
55 -> 62 GESGCGKS
320 -> 334 LVACFAVDQDENPQR
38 -> 189 LDGVSFNLERGKTLAVVGESGCGKSTLGRLLTMIEMPTGGELYYQGQDLLKHDPQAQKLRRQKIQIVFQNPYGSLNPRKKVGQILEEPLLINTSLSKEQRREKALSMMAKVGLKTEHYDRYPHMFSGGQRQRIAIARGLMLDPDVVIADEPV
13 -> 262 LQAIDLKKHYPVKKGMFAPERLVKALDGVSFNLERGKTLAVVGESGCGKSTLGRLLTMIEMPTGGELYYQGQDLLKHDPQAQKLRRQKIQIVFQNPYGSLNPRKKVGQILEEPLLINTSLSKEQRREKALSMMAKVGLKTEHYDRYPHMFSGGQRQRIAIARGLMLDPDVVIADEPVSALDVSVRAQVLNLMMDLQQELGLSYVFISHDLSVVEHIADEVMVMYLGRCVEKGTKDQIFNNPRHPYTQALL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015232 - heme transmembrane transporter activity
GO:0071916 - dipeptide transmembrane transporter activity
biological_process GO:0009314 - response to radiation
GO:0015031 - protein transport
GO:0015833 - peptide transport
GO:0015886 - heme transport
GO:0035442 - dipeptide transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Sargentini NJ., et al., 2016
External database links:  
ECOCYC:
DPPF-MONOMER
ECOLIWIKI:
b3540
INTERPRO:
IPR013563
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MODBASE:
P37313
PFAM:
PF08352
PFAM:
PF00005
PRIDE:
P37313
PRODB:
PRO_000022477
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_417997
SMART:
SM00382
SMR:
P37313
UNIPROT:
P37313


Operon      
Name: dppABCDF         
Operon arrangement:
Transcription unit        Promoter
dppABCDF


Transcriptional Regulation      
Display Regulation             
Activated by: IHF
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4140 3703072 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4141 3703103 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4142 3704129 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4143 3704681 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4144 (cluster) 3704734 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB