RegulonDB RegulonDB 10.8: Gene Form
   

lapB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lapB pyrF lapA pyrFp pyrFp

Gene      
Name: lapB    Texpresso search in the literature
Synonym(s): ECK1275, EG12691, b1280, yciM
Genome position(nucleotides): 1340558 --> 1341727 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.88
External database links:  
ASAP:
ABE-0004300
ECHOBASE:
EB2554
OU-MICROARRAY:
b1280
PortEco:
yciM
STRING:
511145.b1280
COLOMBOS: lapB


Product      
Name: lipopolysaccharide assembly protein B
Synonym(s): LapB, YciM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 44.531
Isoelectric point: 6.326
Motif(s):
 
Type Positions Sequence
191 -> 246 MASDDLDRAMTLLKKGAAADKNSARVSIMMGRVFMAKGEYAKAVESLQRVISQDRE
371 -> 371 C
142 -> 174 GALQQLLQIYQATSEWQKAIDVAERLVKLGKDK
378 -> 378 S
180 -> 213 AHFYCELALQHMASDDLDRAMTLLKKGAAADKNS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031235 - intrinsic component of the cytoplasmic side of the plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0046872 - metal ion binding
GO:0005506 - iron ion binding
biological_process GO:0051301 - cell division
GO:0008653 - lipopolysaccharide metabolic process
GO:0046890 - regulation of lipid biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [AUPEINH] Assay of unpurified protein expressed in its native host
[IGI] Inferred from genetic interaction
[IPI] Inferred from physical interaction
Reference(s): [1] Klein G., et al., 2014
[2] Mahalakshmi S., et al., 2014
[3] Paradis-Bleau C., et al., 2014
[4] Prince C., et al., 2015
External database links:  
DIP:
DIP-48161N
ECOCYC:
EG12691-MONOMER
ECOLIWIKI:
b1280
INTERPRO:
IPR041166
INTERPRO:
IPR030865
INTERPRO:
IPR011990
INTERPRO:
IPR013026
INTERPRO:
IPR019734
MODBASE:
P0AB58
PFAM:
PF18073
PRIDE:
P0AB58
PROSITE:
PS50005
PROSITE:
PS50293
REFSEQ:
NP_415796
SMART:
SM00028
SMR:
P0AB58
UNIPROT:
P0AB58


Operon      
Name: lapAB-pyrF-yciH         
Operon arrangement:
Transcription unit        Promoter
lapAB
yciSM-pyrF-yciH
lapAB
pyrF-yciH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Klein G., Kobylak N., Lindner B., Stupak A., Raina S., 2014, Assembly of lipopolysaccharide in Escherichia coli requires the essential LapB heat shock protein., J Biol Chem 289(21):14829-53

 [2] Mahalakshmi S., Sunayana MR., SaiSree L., Reddy M., 2014, yciM is an essential gene required for regulation of lipopolysaccharide synthesis in Escherichia coli., Mol Microbiol 91(1):145-57

 [3] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [4] Prince C., Jia Z., 2015, An Unexpected Duo: Rubredoxin Binds Nine TPR Motifs to Form LapB, an Essential Regulator of Lipopolysaccharide Synthesis., Structure 23(8):1500-6


RegulonDB