RegulonDB RegulonDB 10.9: Gene Form
   

luxS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

emrB luxS micA CyaR terminator anti-terminator anti-anti-terminator luxSp2 luxSp2 micAp micAp

Gene      
Name: luxS    Texpresso search in the literature
Synonym(s): ECK2681, EG12712, b2687, ygaG
Genome position(nucleotides): 2814218 <-- 2814733 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.55
External database links:  
ASAP:
ABE-0008842
ECHOBASE:
EB2573
ECOLIHUB:
luxS
OU-MICROARRAY:
b2687
STRING:
511145.b2687
COLOMBOS: luxS


Product      
Name: S-ribosylhomocysteine lyase
Synonym(s): LuxS, YgaG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.416
Isoelectric point: 5.041
Motif(s):
 
Type Positions Sequence
2 -> 171 PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI
31 -> 31 D
4 -> 152 LDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVR

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.4 - quorum sensing
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0005506 - iron ion binding
GO:0043768 - S-ribosylhomocysteine lyase activity
biological_process GO:0009372 - quorum sensing
GO:0019284 - L-methionine salvage from S-adenosylmethionine
Note(s): Note(s): ...[more].
Reference(s): [1] Brito PH., et al., 2013
[2] Grillo-Puertas M., et al., 2012
[3] Villa F., et al., 2012
External database links:  
DIP:
DIP-10131N
ECOCYC:
EG12712-MONOMER
ECOLIWIKI:
b2687
INTERPRO:
IPR037005
INTERPRO:
IPR003815
INTERPRO:
IPR011249
MODBASE:
P45578
PANTHER:
PTHR35799
PFAM:
PF02664
PRIDE:
P45578
PRINTS:
PR01487
PRODB:
PRO_000023136
REFSEQ:
NP_417172
SMR:
P45578
SWISSMODEL:
P45578
UNIPROT:
P45578


Operon      
Name: luxS         
Operon arrangement:
Transcription unit        Promoter
luxS
luxS


Transcriptional Regulation      
Display Regulation             
Activated by: UvrY


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Brito PH., Rocha EP., Xavier KB., Gordo I., 2013, Natural genome diversity of AI-2 quorum sensing in Escherichia coli: conserved signal production but labile signal reception., Genome Biol Evol 5(1):16-30

 [2] Grillo-Puertas M., Villegas JM., Rintoul MR., Rapisarda VA., 2012, Polyphosphate degradation in stationary phase triggers biofilm formation via LuxS quorum sensing system in Escherichia coli., PLoS One 7(11):e50368

 [3] Villa F., Remelli W., Forlani F., Vitali A., Cappitelli F., 2012, Altered expression level of Escherichia coli proteins in response to treatment with the antifouling agent zosteric acid sodium salt., Environ Microbiol 14(7):1753-61


RegulonDB