RegulonDB RegulonDB 11.1: Gene Form
   

yecF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sdiA uvrY yecF yecU uvrC LexA yecFp yecFp uvrYp2 uvrYp2 TSS_2249 (cluster) TSS_2249 (cluster) uvrCp3 uvrCp3 TSS_2248 TSS_2248

Gene      
Name: yecF    Texpresso search in the literature
Synonym(s): ECK1914, EG12861, b1915
Genome position(nucleotides): 1995818 --> 1996042
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.0
External database links:  
ASAP:
ABE-0006379
ECHOBASE:
EB2703
ECOLIHUB:
yecF
OU-MICROARRAY:
b1915
STRING:
511145.b1915
COLOMBOS: yecF


Product      
Name: DUF2594 domain-containing protein YecF
Synonym(s): YecF
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.239
Isoelectric point: 4.965
Motif(s):
 
Type Positions Sequence Comment
1 -> 74 MSTPDFSTAENNQELANEVSCLKAMLTLMLQAMGQADAGRVMLKMEKQLALIEDETQAAVFSKTVKQIKQAYRQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P0AD07
ECOCYC:
EG12861-MONOMER
ECOLIWIKI:
b1915
INTERPRO:
IPR019705
PFAM:
PF10769
PRIDE:
P0AD07
REFSEQ:
NP_416425
UNIPROT:
P0AD07


Operon      
Name: yecF         
Operon arrangement:
Transcription unit        Promoter
yecF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2248 1994876 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2249 (cluster) 1995403 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB