RegulonDB RegulonDB 10.9: Gene Form
   

tynA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tynA paaZ feaB FeaR FeaR anti-anti-terminator anti-terminator terminator tynAp tynAp tynAp1 tynAp1

Gene      
Name: tynA    Texpresso search in the literature
Synonym(s): ECK1383, EG13139, b1386, feaA, maoA
Genome position(nucleotides): 1449076 <-- 1451349 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.62
Reference(s): [1] Steinebach V., et al., 1996
External database links:  
ASAP:
ABE-0004639
CGSC:
59
ECHOBASE:
EB2934
ECOLIHUB:
tynA
OU-MICROARRAY:
b1386
STRING:
511145.b1386
COLOMBOS: tynA


Product      
Name: copper-containing amine oxidase
Synonym(s): FeaA, MaoA, TynA
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 84.379
Isoelectric point: 5.715
Motif(s):
 
Type Positions Sequence
36 -> 110 HMVPMDKTLKEFGADVQWDDYAQLFTLIKDGAYVKVKPGAQTAIVNGQPLALQVPVVMKDNKAWVSDTFINDVFQ
42 -> 42 K
248 -> 248 K
411 -> 422 YLDSGDYGMGTL
456 -> 456 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.30 - threonine catabolism
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005507 - copper ion binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0008131 - primary amine oxidase activity
GO:0005509 - calcium ion binding
GO:0042803 - protein homodimerization activity
GO:0048038 - quinone binding
GO:0052593 - tryptamine:oxygen oxidoreductase (deaminating) activity
GO:0052594 - aminoacetone:oxygen oxidoreductase(deaminating) activity
GO:0052595 - aliphatic-amine oxidase activity
GO:0052596 - phenethylamine:oxygen oxidoreductase (deaminating) activity
biological_process GO:0009308 - amine metabolic process
GO:0055114 - oxidation-reduction process
GO:0019607 - phenylethylamine catabolic process
GO:0006559 - L-phenylalanine catabolic process
External database links:  
DIP:
DIP-11057N
ECOCYC:
AMINEOXID-MONOMER
ECOLIWIKI:
b1386
INTERPRO:
IPR036582
INTERPRO:
IPR036460
INTERPRO:
IPR015802
INTERPRO:
IPR016182
INTERPRO:
IPR000269
INTERPRO:
IPR012854
INTERPRO:
IPR015798
INTERPRO:
IPR015800
MODBASE:
P46883
PANTHER:
PTHR10638
PDB:
1D6U
PDB:
6EZZ
PDB:
2WOH
PDB:
2WOF
PDB:
2WO0
PDB:
1D6Y
PDB:
1D6Z
PDB:
1DYU
PDB:
1JRQ
PDB:
1LVN
PDB:
1OAC
PDB:
1QAF
PDB:
1QAK
PDB:
1QAL
PDB:
1SPU
PDB:
2W0Q
PDB:
2WGQ
PFAM:
PF01179
PFAM:
PF02727
PFAM:
PF07833
PFAM:
PF02728
PRIDE:
P46883
PRODB:
PRO_000024148
PROSITE:
PS01165
PROSITE:
PS01164
REFSEQ:
NP_415904
SMR:
P46883
UNIPROT:
P46883


Operon      
Name: tynA         
Operon arrangement:
Transcription unit        Promoter
tynA


Transcriptional Regulation      
Display Regulation             
Activated by: FeaR
Growth Conditions:

[1] 

C: Escherichia coli| M9 minimal medium| glucose 0.5%; thiamine 10 g/mL| oxygen atom| 37.0 C
E: Escherichia coli| M9 minimal medium| succinate 0.5%; thiamine 10 g/mL; tyramine 3 mM| oxygen atom| 37.0 C

[2] 

C: Escherichia coli| M9 minimal medium| glucose 0.5%; thiamine 10 g/mL; tyramine 3 mM| oxygen atom| 37.0 C
E: Escherichia coli| M9 minimal medium| succinate 0.5%; thiamine 10 g/mL; tyramine 3 mM| oxygen atom| 37.0 C

[3] 

C: Escherichia coli| multicopy plasmid pDEL15 (maoB) mutant| M9 minimal medium| glucose 0.5%; thiamine 10 g/mL| oxygen atom| 37.0 C
E: Escherichia coli| multicopy plasmid pDEL15 (maoB) mutant| M9 minimal medium| glucose 0.5%; thiamine 10 g/mL; tyramine 3 mM| oxygen atom| 37.0 C

[4] 

C: Escherichia coli| M9 minimal medium| glucose 0.5%; thiamine 10 g/mL| oxygen atom| 37.0 C
E: Escherichia coli| M9 minimal medium| succinate 0.5%; thiamine 10 g/mL| oxygen atom| 37.0 C

[5] 

C: Escherichia coli| M9 minimal medium| succinate 0.5%; thiamine 10 g/mL| oxygen atom| 37.0 C
E: Escherichia coli| M9 minimal medium| succinate 0.5%; thiamine 10 g/mL; tyramine 3 mM| oxygen atom| 37.0 C



RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tynAp 1451498 reverse nd [AIPP], [ICWHO] [2]


Evidence    

 [AIPP] Automated inference of promoter position

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Steinebach V., Benen JA., Bader R., Postma PW., De Vries S., Duine JA., 1996, Cloning of the maoA gene that encodes aromatic amine oxidase of Escherichia coli W3350 and characterization of the overexpressed enzyme., Eur J Biochem 237(3):584-91

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB