RegulonDB RegulonDB 10.9: Gene Form
   

mngA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mngB mngA mngR MngR MngR mngBp mngBp mngBp2 mngBp2 mngRp mngRp TSS_861 TSS_861 mngAp mngAp

Gene      
Name: mngA    Texpresso search in the literature
Synonym(s): ECK0719, EG13235, b0731, frx, hrsA
Genome position(nucleotides): 765984 --> 767960 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.58
External database links:  
ASAP:
ABE-0002493
ECHOBASE:
EB3024
ECOLIHUB:
mngA
ECOO157CYC:
FRWC_2
OU-MICROARRAY:
b0731
STRING:
511145.b0731
COLOMBOS: mngA


Product      
Name: 2-O-α-mannosyl-D-glycerate specific PTS enzyme II
Synonym(s): EIIHrsA, EIIMngA, EIImannosylglycerate, Enzyme IImannosylglycerate, Frx, HrsA, MngA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 69.668
Isoelectric point: 6.59
Motif(s):
 
Type Positions Sequence
29 -> 170 RDALCLNARFTSREEAIHALTQRLAALGKISSTEQFLEEVYRRESLGPTALGEGLAVPHGKTAAVKEAAFAVATLSEPLQWEGVDGPEAVDLVVLLAIPPNEAGTTHMQLLTALTTRLADDEIRARIQSATTPDELLSALDD
186 -> 282 IVCVTACPAGIAHTYMAAEYLEKAGRKLGVNVYVEKQGANGIEGRLTADQLNSATACIFAAEVAIKESERFNGIPALSVPVAEPIRHAEALIQQALT
390 -> 410 AGLAANMIGSGFLGAVVGGLI
552 -> 572 WLLGLAGITEGAIPMAIEDPL
621 -> 641 IGWFGAALVGAAISTAILLMW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0005351 - carbohydrate:proton symporter activity
GO:0022877 - protein-N(PI)-phosphohistidine-fructose phosphotransferase system transporter activity
GO:0090563 - protein-phosphocysteine-sugar phosphotransferase activity
GO:0090581 - protein-phosphocysteine-mannosylglycerate-phosphotransferase system transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0015755 - fructose transmembrane transport
GO:0034219 - carbohydrate transmembrane transport
GO:1902600 - proton transmembrane transport
GO:0051476 - mannosylglycerate transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9939N
ECOCYC:
HRSA-MONOMER
INTERPRO:
IPR013014
INTERPRO:
IPR013011
INTERPRO:
IPR003501
INTERPRO:
IPR004715
INTERPRO:
IPR002178
INTERPRO:
IPR003352
INTERPRO:
IPR003353
INTERPRO:
IPR016152
INTERPRO:
IPR036095
INTERPRO:
IPR006327
PFAM:
PF02302
PFAM:
PF02378
PFAM:
PF00359
PRIDE:
P54745
PROSITE:
PS51099
PROSITE:
PS51094
PROSITE:
PS00372
PROSITE:
PS51104
REFSEQ:
NP_415259
SMR:
P54745
UNIPROT:
P54745


Operon      
Name: mngAB         
Operon arrangement:
Transcription unit        Promoter
mngAB
mngB
mngB


Transcriptional Regulation      
Display Regulation             
Repressed by: MngR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_861 765899 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB