RegulonDB RegulonDB 10.8: Gene Form
   

emrY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

emrY dsdA emrK evgL evgA EvgA TSS_2668 (cluster) TSS_2668 (cluster) evgAp1 evgAp1 TSS_2666 TSS_2666 evgAp2 evgAp2 TSS_2665 TSS_2665 emrKp emrKp emrYp1 emrYp1 TSS_2664 TSS_2664

Gene      
Name: emrY    Texpresso search in the literature
Synonym(s): ECK2363, EG13283, b2367
Genome position(nucleotides): 2480638 <-- 2482176 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.65
External database links:  
ASAP:
ABE-0007806
ECHOBASE:
EB3068
OU-MICROARRAY:
b2367
PortEco:
emrY
STRING:
511145.b2367
COLOMBOS: emrY


Product      
Name: tripartite efflux pump membrane subunit EmrY
Synonym(s): EmrY
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 56.001
Isoelectric point: 7.951
Motif(s):
 
Type Positions Sequence
23 -> 417 LSLATFMQMLDSTISNVAIPTISGFLGASTDEGTWVITSFGVANAIAIPVTGRLAQRIGELRLFLLSVTFFSLSSLMCSLSTNLDVLIFFRVVQGLMAGPLIPLSQSLLLRNYPPEKRTFALALWSMTVIIAPICGPILGGYICDNFSWGWIFLINVPMGIIVLTLCLTLLKGRETETSPVKMNLPGLTLLVLGVGGLQIMLDKGRDLDWFNSSTIIILTVVSVISLISLVIWESTSENPILDLSLFKSRNFTIGIVSITCAYLFYSGAIVLMPQLLQETMGYNAIWAGLAYAPIGIMPLLISPLIGRYGNKIDMRLLVTFSFLMYAVCYYWRSVTFMPTIDFTGIILPQFFQGFAVACFFLPLTTISFSGLPDNKFANASSMSNFFRTLSGSVG
205 -> 225 MNLPGLTLLVLGVGGLQIMLD
308 -> 328 IWAGLAYAPIGIMPLLISPLI
173 -> 193 WIFLINVPMGIIVLTLCLTLL
339 -> 359 LLVTFSFLMYAVCYYWRSVTF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:1990961 - xenobiotic detoxification by transmembrane export across the plasma membrane
GO:0006974 - cellular response to DNA damage stimulus
GO:0046677 - response to antibiotic
GO:0055085 - transmembrane transport
GO:0015721 - bile acid and bile salt transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9507N
ECOCYC:
EMRY-MONOMER
ECOLIWIKI:
b2367
INTERPRO:
IPR004638
INTERPRO:
IPR036259
INTERPRO:
IPR020846
INTERPRO:
IPR011701
INTERPRO:
IPR001411
MINT:
MINT-1286081
MODBASE:
P52600
PANTHER:
PTHR23501
PFAM:
PF07690
PRIDE:
P52600
PRODB:
PRO_000022513
PROSITE:
PS50850
REFSEQ:
NP_416868
SMR:
P52600
UNIPROT:
P52600


Operon      
Name: emrKY         
Operon arrangement:
Transcription unit        Promoter
emrKY


Transcriptional Regulation      
Display Regulation             
Activated by: EvgA, FNR


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2664 2480013 forward nd [RS-EPT-CBR] [1]
  promoter emrYp1 2482334 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2665 2483630 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2666 2483632 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2668 (cluster) 2483646 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB