RegulonDB RegulonDB 10.9: Gene Form
   

glcF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glcF glcE glcG TSS_3300 TSS_3300

Gene      
Name: glcF    Texpresso search in the literature
Synonym(s): ECK2972, G0-8601, b2978, b4467, gox, yghL
Genome position(nucleotides): 3124236 <-- 3125459 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.56
Reference(s): [1] Pellicer MT., et al., 1996
External database links:  
ASAP:
ABE-0174097
ECHOBASE:
EB3076
ECOLIHUB:
glcF
OU-MICROARRAY:
b2978
STRING:
511145.b4467
COLOMBOS: glcF


Shine dalgarno      
Sequence: gcggaactttGAGGAGcaggcTAT


Product      
Name: glycolate dehydrogenase, putative iron-sulfur subunit
Synonym(s): GlcF, Gox, YghL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 45.11
Isoelectric point: 7.995
Motif(s):
 
Type Positions Sequence
22 -> 89 LRACVHCGFCTATCPTYQLLGDELDGPRGRIYLIKQVLEGNEVTLKTQEHLDRCLTCRNCETTCPSGV
303 -> 385 AFHCPCTLQHAQKLNGEVEKVLLRLGFTLTDVPDSHLCCGSAGTYALTHPDLARQLRDNKMNALESGKPEMIVTANIGCQTHL
14 -> 47 RALEADSILRACVHCGFCTATCPTYQLLGDELDG
66 -> 95 LKTQEHLDRCLTCRNCETTCPSGVRYHNLL
170 -> 255 VLMLEGCAQPTLSPNTNAATARVLDRLGISVMPANEAGCCGAVDYHLNAQEKGLARARNNIDAWWPAIEAGAEAILQTASGCGAFV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.25 - glycolate metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0019154 - glycolate dehydrogenase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0046296 - glycolate catabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [2] Choi SY., et al., 2016
External database links:  
ECOCYC:
MONOMER0-561
ECOLIWIKI:
b4467
INTERPRO:
IPR017900
INTERPRO:
IPR012257
INTERPRO:
IPR017896
INTERPRO:
IPR004017
INTERPRO:
IPR009051
MODBASE:
P52074
PANTHER:
PTHR32479:SF17
PFAM:
PF13183
PFAM:
PF02754
PRIDE:
P52074
PROSITE:
PS51379
PROSITE:
PS00198
REFSEQ:
YP_026190
UNIPROT:
P52074


Operon      
Name: glcDEFGBA         
Operon arrangement:
Transcription unit        Promoter
glcDEFGBA
glcBA


Transcriptional Regulation      
Display Regulation             
Activated by: GlcC, IHF
Repressed by: ArcA, PdhR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3300 3124265 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Pellicer MT., Badia J., Aguilar J., Baldoma L., 1996, glc locus of Escherichia coli: characterization of genes encoding the subunits of glycolate oxidase and the glc regulator protein., J Bacteriol 178(7):2051-9

 [2] Choi SY., Park SJ., Kim WJ., Yang JE., Lee H., Shin J., Lee SY., 2016, One-step fermentative production of poly(lactate-co-glycolate) from carbohydrates in Escherichia coli., Nat Biotechnol 34(4):435-40

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB