RegulonDB RegulonDB 11.0: Gene Form

glcF gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

glcF glcE glcG TSS_3300 TSS_3300

Name: glcF    Texpresso search in the literature
Synonym(s): ECK2972, G0-8601, b2978, b4467, gox, yghL
Genome position(nucleotides): 3124236 <-- 3125459
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
Reference(s): [1] Pellicer MT., et al., 1996
External database links:  

Shine dalgarno      
Sequence: gcggaactttGAGGAGcaggcTAT

Name: glycolate dehydrogenase, putative iron-sulfur subunit
Synonym(s): GlcF, Gox, YghL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 45.11
Isoelectric point: 7.995
Type Positions Sequence Comment
14 -> 47 RALEADSILRACVHCGFCTATCPTYQLLGDELDG UniProt: 4Fe-4S ferredoxin-type 1.
66 -> 95 LKTQEHLDRCLTCRNCETTCPSGVRYHNLL UniProt: 4Fe-4S ferredoxin-type 2.


Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.25 - glycolate metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0047809 - D-2-hydroxy-acid dehydrogenase activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0019154 - glycolate dehydrogenase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0046296 - glycolate catabolic process
Note(s): Note(s): ...[more].
Reference(s): [2] Choi SY., et al., 2016
External database links:  

Name: glcDEFGBA         
Operon arrangement:
Transcription unit        Promoter

Transcriptional Regulation      
Display Regulation             
Activated by: GlcC, IHF
Repressed by: ArcA, PdhR

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3300 3124265 reverse nd [RS-EPT-CBR] [3]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Pellicer MT., Badia J., Aguilar J., Baldoma L., 1996, glc locus of Escherichia coli: characterization of genes encoding the subunits of glycolate oxidase and the glc regulator protein., J Bacteriol 178(7):2051-9

 [2] Choi SY., Park SJ., Kim WJ., Yang JE., Lee H., Shin J., Lee SY., 2016, One-step fermentative production of poly(lactate-co-glycolate) from carbohydrates in Escherichia coli., Nat Biotechnol 34(4):435-40

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
