RegulonDB RegulonDB 10.9: Gene Form
   

pdxB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdxB usg flk yfcJ flKp flKp pdxBp pdxBp TSS_2627 TSS_2627 TSS_2626 TSS_2626 usgp usgp

Gene      
Name: pdxB    Texpresso search in the literature
Synonym(s): ECK2314, G0-9461, b2320, usg-2
Genome position(nucleotides): 2436715 <-- 2437851 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.03
External database links:  
ASAP:
ABE-0007663
ECHOBASE:
EB0686
ECOLIHUB:
pdxB
NCBI-GENE:
946785
STRING:
511145.b2320
COLOMBOS: pdxB


Shine dalgarno      
Sequence: tcgtctcataCAGGTAacacaaaCGT


Product      
Name: erythronate-4-phosphate dehydrogenase
Synonym(s): PdxB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.368
Isoelectric point: 6.678
Motif(s):
 
Type Positions Sequence
109 -> 255 RDGFSLYDRTVGIVGVGNVGRRLQARLEALGIKTLLCDPPRADRGDEGDFRSLDELVQRADILTFHTPLFKDGPYKTLHLADEKLIRSLKPGAILINACRGAVVDNTALLTCLNEGQKLSVVLDVWEGEPELNVELLKKVDIGTSHI
289 -> 369 LLPAPEFGRITLHGPLDQPTLKRLVHLVYDVRRDDAPLRKVAGIPGEFDKLRKNYLERREWSSLYVICDDASAASLLCKLG
9 -> 281 MPYARDLFSRLGEVTAVPGRPIPVAQLADADALMVRSVTKVNESLLAGKPIKFVGTATAGTDHVDEAWLKQAGIGFSAAPGCNAIAVVEYVFSSLLMLAERDGFSLYDRTVGIVGVGNVGRRLQARLEALGIKTLLCDPPRADRGDEGDFRSLDELVQRADILTFHTPLFKDGPYKTLHLADEKLIRSLKPGAILINACRGAVVDNTALLTCLNEGQKLSVVLDVWEGEPELNVELLKKVDIGTSHIAGYTLEGKARGTTQVFEAYSKFIGHE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.6 - pyridoxal 5'phosphate
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0042803 - protein homodimerization activity
GO:0046983 - protein dimerization activity
GO:0051287 - NAD binding
GO:0033711 - 4-phosphoerythronate dehydrogenase activity
biological_process GO:0008615 - pyridoxine biosynthetic process
GO:0055114 - oxidation-reduction process
GO:0036001 - 'de novo' pyridoxal 5'-phosphate biosynthetic process
External database links:  
DIP:
DIP-10449N
ECOCYC:
ERYTHRON4PDEHYDROG-MONOMER
ECOLIWIKI:
b2320
INTERPRO:
IPR036291
INTERPRO:
IPR029753
INTERPRO:
IPR029752
INTERPRO:
IPR038251
INTERPRO:
IPR006139
INTERPRO:
IPR006140
INTERPRO:
IPR020921
INTERPRO:
IPR024531
MODBASE:
P05459
PANTHER:
PTHR42938:SF3
PFAM:
PF02826
PFAM:
PF11890
PFAM:
PF00389
PRIDE:
P05459
PRODB:
PRO_000023503
PROSITE:
PS00671
PROSITE:
PS00065
REFSEQ:
NP_416823
SMR:
P05459
UNIPROT:
P05459


Operon      
Name: pdxB-usg-truA-dedA         
Operon arrangement:
Transcription unit        Promoter
usg-truA-dedA
pdxB-usg-truA-dedA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2626 2437519 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2627 2437883 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB