RegulonDB RegulonDB 11.0: Gene Form
   

prpE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

prpE prpD codB codA PurR Nac codBp codBp

Gene      
Name: prpE    Texpresso search in the literature
Synonym(s): ECK0332, G6200, b0335, yahU
Genome position(nucleotides): 352706 --> 354592
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.4
External database links:  
ASAP:
ABE-0001154
ECHOBASE:
EB3372
ECOLIHUB:
prpE
OU-MICROARRAY:
b0335
STRING:
511145.b0335
COLOMBOS: prpE


Product      
Name: propionyl-CoA synthetase
Synonym(s): PrpE, YahU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 69.351
Isoelectric point: 5.842
Motif(s):
 
Type Positions Sequence Comment
5 -> 57 EFYQRSINEPEQFWAEQARRIDWQTPFTQTLDHSNPPFARWFCEGRTNLCHNA
59 -> 500 DRWLEKQPEALALIAVSSETEEERTFTFRQLHDEVNAVASMLRSLGVQRGDRVLVYMPMIAEAHITLLACARIGAIHSVVFGGFASHSVAARIDDAKPVLIVSADAGARGGKIIPYKKLLDDAISQAQHQPRHVLLVDRGLAKMARVSGRDVDFASLRHQHIGARVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGSVFFCASDIGWVVGHSYIVYAPLLAGMATIVYEGLPTWPDCGVWWTIVEKYQVSRMFSAPTAIRVLKKFPTAEIRKHDLSSLEVLYLAGEPLDEPTASWVSNTLDVPVIDNYWQTESGWPIMAIARGLDDRPTRLGSPGVPMYGYNVQLLNEVTGEPCGVNEKGMLVVEGPLPPGCIQTIWGDDGRFVKTYWSLFSRPVYATFDWGIRDADGYHFILGRTDDVINV
509 -> 592 EIEESISSHPGVAEVAVVGVKDALKGQVAVAFVIPKESDSLEDRDVAHSQEKAIMALVDSQIGNFGRPAHVWFVSQLPKTRSGK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0050218 - propionate-CoA ligase activity
biological_process GO:0019629 - propionate catabolic process, 2-methylcitrate cycle
Note(s): Note(s): ...[more].
Reference(s): [1] Armando JW., et al., 2012
[2] Feng X., et al., 2015
[3] Tian T., et al., 2019
[4] Wang Q., et al., 2012
[5] Wang Q., et al., 2014
[6] Zhang H., et al., 2010
External database links:  
ALPHAFOLD:
P77495
ECOCYC:
G6200-MONOMER
ECOLIWIKI:
b0335
INTERPRO:
IPR012694
INTERPRO:
IPR000873
INTERPRO:
IPR025110
INTERPRO:
IPR042099
INTERPRO:
IPR032387
INTERPRO:
IPR020845
MODBASE:
P77495
PFAM:
PF13193
PFAM:
PF00501
PFAM:
PF16177
PRIDE:
P77495
PRODB:
PRO_000023609
PROSITE:
PS00455
REFSEQ:
NP_414869
SMR:
P77495
UNIPROT:
P77495


Operon      
Name: prpBCDE         
Operon arrangement:
Transcription unit        Promoter
prpBCDE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, PrpR
Repressed by: Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Armando JW., Boghigian BA., Pfeifer BA., 2012, LC-MS/MS quantification of short-chain acyl-CoA's in Escherichia coli demonstrates versatile propionyl-CoA synthetase substrate specificity., Lett Appl Microbiol 54(2):140-8

 [2] Feng X., Xian M., Liu W., Xu C., Zhang H., Zhao G., 2015, Biosynthesis of poly(3-hydroxypropionate) from glycerol using engineered Klebsiella pneumoniae strain without vitamin B12., Bioengineered 6(2):77-81

 [3] Tian T., Kang JW., Kang A., Lee TS., 2019, Redirecting Metabolic Flux via Combinatorial Multiplex CRISPRi-Mediated Repression for Isopentenol Production in Escherichia coli., ACS Synth Biol 8(2):391-402

 [4] Wang Q., Liu C., Xian M., Zhang Y., Zhao G., 2012, Biosynthetic pathway for poly(3-hydroxypropionate) in recombinant Escherichia coli., J Microbiol 50(4):693-7

 [5] Wang Q., Yang P., Xian M., Feng L., Wang J., Zhao G., 2014, Metabolic engineering of Escherichia coli for poly(3-hydroxypropionate) production from glycerol and glucose., Biotechnol Lett 36(11):2257-62

 [6] Zhang H., Boghigian BA., Pfeifer BA., 2010, Investigating the role of native propionyl-CoA and methylmalonyl-CoA metabolism on heterologous polyketide production in Escherichia coli., Biotechnol Bioeng 105(3):567-73


RegulonDB