RegulonDB RegulonDB 10.9: Gene Form
   

dsbG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybdO dsbG ahpC MetJ MetJ OxyR OxyR OxyR OxyR FNR CysB FNR TSS_741 TSS_741 TSS_740 TSS_740 TSS_739 TSS_739 ahpFp ahpFp TSS_738 TSS_738 TSS_737 TSS_737 ahpCp ahpCp TSS_735 TSS_735 TSS_734 (cluster) TSS_734 (cluster) TSS_733 (cluster) TSS_733 (cluster) dsbGp dsbGp TSS_732 TSS_732 ahpCp2 ahpCp2 TSS_731 TSS_731 TSS_730 TSS_730 TSS_729 TSS_729

Gene      
Name: dsbG    Texpresso search in the literature
Synonym(s): ECK0598, G6333, b0604, ybdP
Genome position(nucleotides): 637827 <-- 638573 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.85
External database links:  
ASAP:
ABE-0002084
ECHOBASE:
EB3306
ECOLIHUB:
dsbG
OU-MICROARRAY:
b0604
STRING:
511145.b0604
COLOMBOS: dsbG


Product      
Name: protein sulfenic acid reductase and chaperone DsbG
Synonym(s): DsbG, YbdP
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 27.495
Isoelectric point: 8.565
Motif(s):
 
Type Positions Sequence
233 -> 233 V
79 -> 104 NLSNTLIEKEIYAPAGREMWQRMEQS
130 -> 130 K
18 -> 78 EELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGE
129 -> 129 C

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0003756 - protein disulfide isomerase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0061077 - chaperone-mediated protein folding
External database links:  
DIP:
DIP-9478N
ECOCYC:
DSBG-MONOMER
ECOLIWIKI:
b0604
INTERPRO:
IPR036249
INTERPRO:
IPR033954
INTERPRO:
IPR012336
INTERPRO:
IPR009094
MODBASE:
P77202
PDB:
5G1L
PDB:
1V57
PDB:
1V58
PDB:
5G1K
PDB:
2H0G
PDB:
2H0I
PDB:
2H0H
PDB:
2IY2
PFAM:
PF13098
PRIDE:
P77202
PRODB:
PRO_000022484
REFSEQ:
NP_415137
SMR:
P77202
UNIPROT:
P77202


Operon      
Name: dsbG         
Operon arrangement:
Transcription unit        Promoter
 


Transcriptional Regulation      
Display Regulation             
Activated by: OxyR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_729 637288 forward nd [RS-EPT-CBR] [1]
  promoter TSS_730 638601 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_731 638629 forward nd [RS-EPT-CBR] [1]
  promoter TSS_732 638782 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_733 (cluster) 638831 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_734 (cluster) 638834 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_735 638918 forward nd [RS-EPT-CBR] [1]
  promoter TSS_737 638966 forward nd [RS-EPT-CBR] [1]
  promoter TSS_738 638974 forward nd [RS-EPT-CBR] [1]
  promoter TSS_739 639004 forward nd [RS-EPT-CBR] [1]
  promoter TSS_740 639027 forward nd [RS-EPT-CBR] [1]
  promoter TSS_741 639070 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB