RegulonDB RegulonDB 10.9: Gene Form
   

ybiX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fiu ybiX ybiI ybiXp2 ybiXp2 ybiIp6 ybiIp6

Gene      
Name: ybiX    Texpresso search in the literature
Synonym(s): ECK0793, G6413, b0804
Genome position(nucleotides): 838530 <-- 839207 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.95
External database links:  
ASAP:
ABE-0002746
ECHOBASE:
EB3100
ECOLIHUB:
ybiX
OU-MICROARRAY:
b0804
STRING:
511145.b0804
COLOMBOS: ybiX


Product      
Name: PKHD-type hydroxylase YbiX
Synonym(s): YbiX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.529
Isoelectric point: 6.402
Motif(s):
 
Type Positions Sequence
84 -> 175 FNRYQNNETYGFHVDGAVRSHPQNGWMRTDLSATLFLSDPQSYDGGELVVNDTFGQHRVKLPAGDLVLYPSSSLHCVTPVTRGVRVASFMWI
78 -> 177 TLSTPLFNRYQNNETYGFHVDGAVRSHPQNGWMRTDLSATLFLSDPQSYDGGELVVNDTFGQHRVKLPAGDLVLYPSSSLHCVTPVTRGVRVASFMWIQS
182 -> 224 DKKRAMLFELDNNIQSLKSRYGESEEILSLLNLYHNLLREWSE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016705 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016706 - 2-oxoglutarate-dependent dioxygenase activity
GO:0005506 - iron ion binding
GO:0051213 - dioxygenase activity
GO:0031418 - L-ascorbic acid binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0006879 - cellular iron ion homeostasis
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6413-MONOMER
ECOLIWIKI:
b0804
INTERPRO:
IPR041097
INTERPRO:
IPR023550
INTERPRO:
IPR006620
INTERPRO:
IPR005123
PANTHER:
PTHR41536
PFAM:
PF18331
PFAM:
PF13640
PRIDE:
P75779
PROSITE:
PS51471
REFSEQ:
NP_415325
SMART:
SM00702
SMR:
P75779
UNIPROT:
P75779


Operon      
Name: ybiX         
Operon arrangement:
Transcription unit        Promoter
ybiX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybiXp2 839274 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB