RegulonDB RegulonDB 11.0: Gene Form
   

ybjT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybjT ybjS ltaE amiD anti-anti-terminator anti-terminator terminator ybjSp3 ybjSp3

Gene      
Name: ybjT    Texpresso search in the literature
Synonym(s): ECK0860, G6454, b0869
Genome position(nucleotides): 906852 <-- 908282
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.0
External database links:  
ASAP:
ABE-0002951
ECHOBASE:
EB3453
ECOLIHUB:
ybjT
OU-MICROARRAY:
b0869
STRING:
511145.b0869
COLOMBOS: ybjT


Product      
Name: putative NAD(P)-binding protein YbjT
Synonym(s): YbjT, putative NAD(P)-dependent oxidoreductase YbjT
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 53.707
Isoelectric point: 9.151
Motif(s):
 
Type Positions Sequence Comment
9 -> 148 GASGYIGQHLVRTLSQQGHQILAAARHVDRLAKLQLANVSCHKVDLSWPDNLPALLQDIDTVYFLVHSMGEGGDFIAQERQVALNVRDALREVPVKQLIFLSSLQAPPHEQSDHLRARQATADILREANVPVTELRAGII
331 -> 463 TVKTSASLAALWQVVNQIGGKERYFFGNILWQTRALMDRAIGHKLAKGRPEREYLQTGDAVDSWKVIVVEPEKQLTLLFGMKAPGLGRLCFSLEDKGDYRTIDVRAFWHPHGMPGLFYWLLMIPAHLFIFRGM
440 -> 460 PHGMPGLFYWLLMIPAHLFIF UniProt: Helical.

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P75822
ECOCYC:
G6454-MONOMER
ECOLIWIKI:
b0869
INTERPRO:
IPR036291
INTERPRO:
IPR021295
INTERPRO:
IPR016040
MODBASE:
P75822
PFAM:
PF11066
PFAM:
PF13460
PRIDE:
P75822
REFSEQ:
NP_415390
UNIPROT:
P75822


Operon      
Name: hcp-hcr-poxB-ltaE-ybjT         
Operon arrangement:
Transcription unit        Promoter
ltaE-ybjT
poxB
poxB
hcp-hcr
hcp-hcr-poxB
hcp-hcr
poxB-ltaE-ybjT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybjSp3 906898 reverse nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB