RegulonDB RegulonDB 10.8: Gene Form
   

rutE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rutD rutE rutF rutGp2 rutGp2

Gene      
Name: rutE    Texpresso search in the literature
Synonym(s): ECK0999, G6519, b1008, ycdI
Genome position(nucleotides): 1070365 <-- 1070955 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.19
External database links:  
ASAP:
ABE-0003407
ECHOBASE:
EB3615
OU-MICROARRAY:
b1008
PortEco:
rutE
STRING:
511145.b1008
COLOMBOS: rutE


Product      
Name: putative malonic semialdehyde reductase
Synonym(s): RutE, YcdI
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 21.57
Isoelectric point: 6.262
Motif(s):
 
Type Positions Sequence
18 -> 174 RTHNGWRETPVSDETLREIYALMKWGPTSANCSPARIVFTRTAEGKERLRPALSSGNLQKTLTAPVTAIVAWDSEFYERLPLLFPHGDARSWFTSSPQLAEETAFRNSSMQAAYLIVACRALGLDTGPMSGFDRQHVDDAFFTGSTLKSNLLINIGY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
Gene Ontology Terms (GO)  
molecular_function GO:0016491 - oxidoreductase activity
GO:0010181 - FMN binding
GO:0035527 - 3-hydroxypropionate dehydrogenase (NADP+) activity
biological_process GO:0006208 - pyrimidine nucleobase catabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0019740 - nitrogen utilization
GO:0055114 - oxidation-reduction process
GO:0006212 - uracil catabolic process
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Loh KD., et al., 2006
[2] Zimmer DP., et al., 2000
External database links:  
ECOCYC:
G6519-MONOMER
ECOLIWIKI:
b1008
INTERPRO:
IPR000415
INTERPRO:
IPR029479
INTERPRO:
IPR023936
MODBASE:
P75894
PFAM:
PF00881
PRIDE:
P75894
REFSEQ:
NP_415528
SMR:
P75894
UNIPROT:
P75894


Operon      
Name: rutABCDEFG         
Operon arrangement:
Transcription unit        Promoter
rutABCDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP, NtrC, ArcA
Repressed by: RutR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rutGp2 1070045 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Loh KD., Gyaneshwar P., Markenscoff Papadimitriou E., Fong R., Kim KS., Parales R., Zhou Z., Inwood W., Kustu S., 2006, A previously undescribed pathway for pyrimidine catabolism., Proc Natl Acad Sci U S A 103(13):5114-9

 [2] Zimmer DP., Soupene E., Lee HL., Wendisch VF., Khodursky AB., Peter BJ., Bender RA., Kustu S., 2000, Nitrogen regulatory protein C-controlled genes of Escherichia coli: scavenging as a defense against nitrogen limitation., Proc Natl Acad Sci U S A 97(26):14674-9

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB