RegulonDB RegulonDB 10.8: Gene Form
   

yciO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yciQ yciV yciO trpL TrpR TrpR TrpR Cis-reg; leader anti-anti-terminator terminator TSS_1703 (cluster) TSS_1703 (cluster) TSS_1702 TSS_1702 yciVp yciVp trpLp trpLp

Gene      
Name: yciO    Texpresso search in the literature
Synonym(s): ECK1261, G6635, b1267
Genome position(nucleotides): 1324098 --> 1324718 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.15
External database links:  
ASAP:
ABE-0004254
ECHOBASE:
EB2796
OU-MICROARRAY:
b1267
PortEco:
yciO
STRING:
511145.b1267
COLOMBOS: yciO


Product      
Name: putative RNA-binding protein YciO
Synonym(s): YciO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.212
Isoelectric point: 6.275
Motif(s):
 
Type Positions Sequence
14 -> 200 QRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNFTLMCRDLSELSTYSFVDNVAFRLMKNNTPGNYTFILKGTKEVPRRLLQEKRKTIGMRVPSNPIAQALLEALGEPMLSTSLMLPGSEFTESDPEEIKDRLEKQVDLIIHGGYLGQKPTTVIDLTDDTPVVVREGVG
23 -> 198 IVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNFTLMCRDLSELSTYSFVDNVAFRLMKNNTPGNYTFILKGTKEVPRRLLQEKRKTIGMRVPSNPIAQALLEALGEPMLSTSLMLPGSEFTESDPEEIKDRLEKQVDLIIHGGYLGQKPTTVIDLTDDTPVVVREG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003725 - double-stranded RNA binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6635-MONOMER
ECOLIWIKI:
b1267
INTERPRO:
IPR006070
INTERPRO:
IPR017945
MINT:
MINT-1308678
MODBASE:
P0AFR4
PDB:
1KK9
PDB:
1K7J
PFAM:
PF01300
PRIDE:
P0AFR4
PROSITE:
PS51163
REFSEQ:
NP_415783
SMR:
P0AFR4
SWISSMODEL:
P0AFR4
UNIPROT:
P0AFR4


Operon      
Name: yciVOQ         
Operon arrangement:
Transcription unit        Promoter
yciVOQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1702 1323345 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1703 (cluster) 1326296 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB