RegulonDB RegulonDB 10.8: Gene Form
   

yciQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yciQ rluB yciO yciV terminator TSS_1708 TSS_1708 TSS_1707 TSS_1707 TSS_1706 TSS_1706 TSS_1705 TSS_1705 TSS_1704 (cluster) TSS_1704 (cluster) TSS_1703 (cluster) TSS_1703 (cluster)

Gene      
Name: yciQ    Texpresso search in the literature
Synonym(s): ECK1262, G6636, b1268, yciP
Genome position(nucleotides): 1324746 --> 1326641 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.99
External database links:  
ASAP:
ABE-0004256
ECHOBASE:
EB2797
OU-MICROARRAY:
b1268
PortEco:
yciQ
STRING:
511145.b1268
COLOMBOS: yciQ


Product      
Name: DUF2207 domain-containing protein YciQ
Synonym(s): YciP, YciQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 71.289
Isoelectric point: 8.097
Motif(s):
 
Type Positions Sequence
616 -> 630 GGGAGGGAGGGGGGG
35 -> 572 ISLFDVEATLQPDGVLDIKENIHFQARNQQIKHGFYRDLPRLWMQPDGDAALLNYHIVGVTRDGIPEPWHLDWHIGLMSIVVGDKQRFLPQGDYHYQIHYQVKNAFLREGDSDLLIWNVTGNHWPFEIYKTRFSLQFSNIAGNPFSEIDLFTGEEGDTYRNGRILEDGRIESRDPFYREDFTVLYRWPHALLSNASAPQTTNIFSHLLLPSTSSLLIWFPCLFLVCGWLYLWKRRPQFTPVDVIETDVIPPDYTPGMLRLDAKLVYDDKGFCADIVNLIVKGKIHLEDQSDKNQQILIRVNEGATRNNAVLLPAEQLLLEALFRKGDKVVLTGRRNRVLRRAFLRMQKFYLPRKKSSFYRSDTFLQWGGLAILAVILYGNLSPVGWAGMSLVGDMFIMICWIIPFLFCSLELLFARDDDKPCVNRVIITLFLPLICSGVAFYSLYINVGDVFFYWYMPAGYFTAVCLTGYLTGMGYIFLPKFTQTGQQRYAHGEAIVNYLARKEAATHSGRRRKGETRKLDYALLGWAISANLGREWA
84 -> 84 A
88 -> 88 N

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6636-MONOMER
ECOLIWIKI:
b1268
INTERPRO:
IPR018702
PFAM:
PF09972
PRIDE:
P45848
REFSEQ:
NP_415784
SMR:
P45848
UNIPROT:
P45848


Operon      
Name: yciVOQ         
Operon arrangement:
Transcription unit        Promoter
yciVOQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1703 (cluster) 1326296 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1704 (cluster) 1326918 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1705 1326921 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1706 1326973 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1707 1326992 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1708 1327047 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB