RegulonDB RegulonDB 10.7: Gene Form
   

tpx gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tyrR ycjG tpx mpaA ArcA FNR ycjGp ycjGp tpxp tpxp TSS_1749 TSS_1749 TSS_1748 (cluster) TSS_1748 (cluster) TSS_1747 TSS_1747

Gene      
Name: tpx    Texpresso search in the literature
Synonym(s): ECK1320, G6660, b1324, yzzJ
Genome position(nucleotides): 1388305 <-- 1388811 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.28
External database links:  
ASAP:
ABE-0004442
ECHOBASE:
EB2538
OU-MICROARRAY:
b1324
PORTECO:
tpx
REGULONDB:
b1324
STRING:
511145.b1324
M3D: tpx
COLOMBOS: tpx
PortEco: b1324


Product      
Name: lipid hydroperoxide peroxidase
Synonym(s): Tpx, YzzJ, p20, scavengase, scavengase p20, thiol peroxidase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,periplasmic space
Molecular weight: 17.835
Isoelectric point: 4.52
Motif(s):
 
Type Positions Sequence
2 -> 168 SQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA
82 -> 82 C
61 -> 61 C
19 -> 168 PQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA
20 -> 163 QAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAAL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0042597 - periplasmic space
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0004601 - peroxidase activity
GO:0016209 - antioxidant activity
GO:0016684 - oxidoreductase activity, acting on peroxide as acceptor
GO:0008379 - thioredoxin peroxidase activity
GO:0051920 - peroxiredoxin activity
GO:0032843 - hydroperoxide reductase activity
biological_process GO:0045454 - cell redox homeostasis
GO:0055114 - oxidation-reduction process
GO:0034599 - cellular response to oxidative stress
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-31857N
ECOCYC:
G6660-MONOMER
ECOLIWIKI:
b1324
INTERPRO:
IPR036249
INTERPRO:
IPR013766
INTERPRO:
IPR002065
INTERPRO:
IPR013740
INTERPRO:
IPR018219
MODBASE:
P0A862
PDB:
3I43
PDB:
3HVX
PDB:
3HVV
PDB:
3HVS
PDB:
1QXH
PDB:
4AF2
PFAM:
PF08534
PRIDE:
P0A862
PRODB:
PRO_000024095
PROSITE:
PS01265
PROSITE:
PS51352
PROTEINMODELPORTAL:
P0A862
REFSEQ:
NP_415840
SMR:
P0A862
UNIPROT:
P0A862


Operon      
Name: tpx         
Operon arrangement:
Transcription unit        Promoter
tpx


Transcriptional Regulation      
Display Regulation             
Repressed by: FNR, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1747 1387697 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1748 (cluster) 1388610 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1749 1388656 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB