RegulonDB RegulonDB 10.7: Gene Form
   

mpaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycjG mpaA tpx ymjC ArcA FNR TSS_1752 TSS_1752 mpaAp4 mpaAp4 mpaAp2 mpaAp2 TSS_1751 TSS_1751 TSS_1750 TSS_1750 ycjGp ycjGp tpxp tpxp TSS_1749 TSS_1749 TSS_1748 (cluster) TSS_1748 (cluster)

Gene      
Name: mpaA    Texpresso search in the literature
Synonym(s): ECK1322, G6662, b1326, ycjI
Genome position(nucleotides): 1389870 <-- 1390598 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.87
External database links:  
ASAP:
ABE-0004450
ECHOBASE:
EB3665
MIM:
212070
OU-MICROARRAY:
b1326
PORTECO:
mpaA
REGULONDB:
b1326
STRING:
511145.b1326
M3D: mpaA
COLOMBOS: mpaA
PortEco: b1326


Product      
Name: murein tripeptide amidase A
Synonym(s): MpaA, YcjI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.558
Isoelectric point: 5.792
Motif(s):
 
Type Positions Sequence
43 -> 157 LILAGTHGDENSSVVTLSCALRTLTPSLRRHHVVLCVNPDGCQLGLRANANGVDLNRNFPAANWKEGETVYRWNSAAEERDVVLLTGDKPGSEPETQALCQLIHRIQPAWVVSFH

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004180 - carboxypeptidase activity
GO:0008270 - zinc ion binding
GO:0004181 - metallocarboxypeptidase activity
GO:0008237 - metallopeptidase activity
GO:0004040 - amidase activity
GO:0042803 - protein homodimerization activity
GO:0061473 - murein tripeptide carboxypeptidase activity
biological_process GO:0006508 - proteolysis
GO:0009050 - glycopeptide catabolic process
GO:0009253 - peptidoglycan catabolic process
GO:0016998 - cell wall macromolecule catabolic process
GO:0071555 - cell wall organization
External database links:  
ECOCYC:
G6662-MONOMER
ECOLIWIKI:
b1326
INTERPRO:
IPR000834
MODBASE:
P0ACV6
PDB:
5HXD
PFAM:
PF00246
PRIDE:
P0ACV6
PRODB:
PRO_000023276
PROTEINMODELPORTAL:
P0ACV6
REFSEQ:
NP_415842
SMR:
P0ACV6
UNIPROT:
P0ACV6


Operon      
Name: ycjY-ymjDC-mpaA         
Operon arrangement:
Transcription unit        Promoter
ycjY-ymjDC-mpaA
 
 


Transcriptional Regulation      
Display Regulation             
Repressed by: PgrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1748 (cluster) 1388610 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1749 1388656 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1750 1390618 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1751 1390623 reverse nd [RS-EPT-CBR] [1]
  promoter mpaAp2 1390637 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter mpaAp4 1390639 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1752 1390681 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB