RegulonDB RegulonDB 10.9: Gene Form
   

paaZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tynA paaZ paaA PaaX SlyA CRP SlyA IHF SlyA PaaX FeaR FeaR anti-anti-terminator anti-terminator terminator paaAp paaAp paaZp paaZp tynAp tynAp tynAp1 tynAp1

Gene      
Name: paaZ    Texpresso search in the literature
Synonym(s): ECK1384, G6708, b1387, maoC, ydbN
Genome position(nucleotides): 1451597 <-- 1453642 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.2
External database links:  
ASAP:
ABE-0004644
ECHOBASE:
EB3498
ECOLIHUB:
maoC
OU-MICROARRAY:
b1387
STRING:
511145.b1387
COLOMBOS: paaZ


Product      
Name: fused 3-oxo-5,6-dehydrosuberyl-CoA semialdehyde dehydrogenase and oxepin-CoA hydrolase
Synonym(s): MaoC, PaaZ, YdbN, oxepin-CoA hydrolase/3-oxo-5,6-dehydrosuberyl-CoA semialdehyde dehydrogenase
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 73.003
Isoelectric point: 6.427
Motif(s):
 
Type Positions Sequence
256 -> 256 E
1 -> 333 MQQLASFLSGTWQSGRGRSRLIHHAISGEALWEVTSEGLDMAAARQFAIEKGAPALRAMTFIERAAMLKAVAKHLLSEKERFYALSAQTGATRADSWVDIEGGIGTLFTYASLGSRELPDDTLWPEDELIPLSKEGGFAARHLLTSKSGVAVHINAFNFPCWGMLEKLAPTWLGGMPAIIKPATATAQLTQAMVKSIVDSGLVPEGAISLICGSAGDLLDHLDSQDVVTFTGSAATGQMLRVQPNIVAKSIPFTMEADSLNCCVLGEDVTPDQPEFALFIREVVREMTTKAGQKCTAIRRIIVPQALVNAVSDALVARLQKVVVGDPAQEGVK
440 -> 440 A
537 -> 648 GDSLLTPRRTMTEADIVNFACLSGDHFYAHMDKIAAAESIFGERVVHGYFVLSAAAGLFVDAGVGPVIANYGLESLRFIEPVKPGDTIQVRLTCKRKTLKKQRSAEEKPTGV
143 -> 143 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0016829 - lyase activity
GO:0016491 - oxidoreductase activity
GO:0016803 - ether hydrolase activity
GO:0016620 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0004300 - enoyl-CoA hydratase activity
GO:0016726 - oxidoreductase activity, acting on CH or CH2 groups, NAD or NADP as acceptor
GO:0042802 - identical protein binding
GO:0016823 - hydrolase activity, acting on acid carbon-carbon bonds, in ketonic substances
biological_process GO:0008152 - metabolic process
GO:0010124 - phenylacetate catabolic process
GO:0055114 - oxidation-reduction process
External database links:  
ECOCYC:
G6708-MONOMER
ECOLIWIKI:
b1387
INTERPRO:
IPR016163
INTERPRO:
IPR016161
INTERPRO:
IPR029069
INTERPRO:
IPR016162
INTERPRO:
IPR002539
INTERPRO:
IPR011966
INTERPRO:
IPR015590
MODBASE:
P77455
PDB:
6JQM
PDB:
6JQN
PDB:
6JQL
PDB:
6JQO
PFAM:
PF01575
PFAM:
PF00171
PRIDE:
P77455
PRODB:
PRO_000023164
PROSITE:
PS00070
REFSEQ:
NP_415905
SMR:
P77455
SWISSMODEL:
P77455
UNIPROT:
P77455


Operon      
Name: paaZ         
Operon arrangement:
Transcription unit        Promoter
paaZ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, IHF
Repressed by: PaaX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tynAp 1451498 reverse nd [AIPP], [ICWHO] [1]


Evidence    

 [AIPP] Automated inference of promoter position

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB