RegulonDB RegulonDB 10.8: Gene Form
   

adhP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

maeA adhP yddM adhPp5 adhPp5 TSS_1831 TSS_1831

Gene      
Name: adhP    Texpresso search in the literature
Synonym(s): ECK1472, G6775, b1478, yddN
Genome position(nucleotides): 1552828 <-- 1553838 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.42
External database links:  
ASAP:
ABE-0004928
ECHOBASE:
EB2506
OU-MICROARRAY:
b1478
PortEco:
adhP
STRING:
511145.b1478
COLOMBOS: adhP


Product      
Name: ethanol dehydrogenase / alcohol dehydrogenase
Synonym(s): AdhP, YddN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.38
Isoelectric point: 6.351
Motif(s):
 
Type Positions Sequence
172 -> 298 GLGNLALQYAKNVFNAKVIAIDVNDEQLKLATEMGADLAINSHTEDAAKIVQEKTGGAHAAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAA
25 -> 131 GEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEECIVVADYAVKV
108 -> 108 N
112 -> 112 S
90 -> 90 G

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0008270 - zinc ion binding
GO:0004022 - alcohol dehydrogenase (NAD+) activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0055114 - oxidation-reduction process
GO:0045471 - response to ethanol
GO:0046187 - acetaldehyde catabolic process
External database links:  
ECOCYC:
ADHP-MONOMER
ECOLIWIKI:
b1478
INTERPRO:
IPR020843
INTERPRO:
IPR013149
INTERPRO:
IPR011032
INTERPRO:
IPR013154
INTERPRO:
IPR036291
INTERPRO:
IPR002328
MODBASE:
P39451
PANTHER:
PTHR11695
PDB:
4GKV
PFAM:
PF08240
PFAM:
PF00107
PRIDE:
P39451
PRODB:
PRO_000022057
PROSITE:
PS00059
REFSEQ:
NP_415995
SMART:
SM00829
SMR:
P39451
SWISSMODEL:
P39451
UNIPROT:
P39451


Operon      
Name: adhP         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1831 1552712 reverse nd [RS-EPT-CBR] [1]
  promoter adhPp5 1553994 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB