RegulonDB RegulonDB 10.7: Gene Form
   

bdm gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

osmC bdm sra RcsB NhaR Lrp RcsB ppGpp terminator osmCp2 osmCp2 TSS_1833 TSS_1833 osmCp1 osmCp1 bdmp bdmp srap srap

Gene      
Name: bdm    Texpresso search in the literature
Synonym(s): ECK1475, G6776, b1481, yddX
Genome position(nucleotides): 1556065 <-- 1556280 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.37
External database links:  
ASAP:
ABE-0004938
ECHOBASE:
EB4048
ECOL199310CYC:
C1914
OU-MICROARRAY:
b1481
PORTECO:
bdm
REGULONDB:
b1481
STRING:
511145.b1481
M3D: bdm
COLOMBOS: bdm
PortEco: b1481


Product      
Name: biofilm-dependent modulation protein
Synonym(s): Bdm, YddX, f92
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.987
Isoelectric point: 3.821
Motif(s):
 
Type Positions Sequence
1 -> 71 MFTYYQAENSTAEPALVNAIEQGLRAQHGVVTEDDILMELTKWVEASDNDILSDIYQQTINYVVSGQHPTL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
Gene Ontology Terms (GO)  
biological_process GO:1902210 - positive regulation of bacterial-type flagellum assembly
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Kim JS., et al., 2015
[2] Kim K., et al., 2011
External database links:  
ECOCYC:
G6776-MONOMER
ECOLIWIKI:
b1481
INTERPRO:
IPR019625
PFAM:
PF10684
PRIDE:
P76127
PRODB:
PRO_000022206
PROTEINMODELPORTAL:
P76127
REFSEQ:
NP_415998
UNIPROT:
P76127


Operon      
Name: bdm-sra         
Operon arrangement:
Transcription unit        Promoter
sra
bdm-sra


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1833 1556600 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kim JS., Kim YJ., Seo S., Seong MJ., Lee K., 2015, Functional role of bdm during flagella biogenesis in Escherichia coli., Curr Microbiol 70(3):369-73

 [2] Kim K., Sim SH., Jeon CO., Lee Y., Lee K., 2011, Base substitutions at scissile bond sites are sufficient to alter RNA-binding and cleavage activity of RNase III., FEMS Microbiol Lett 315(1):30-7

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB