RegulonDB RegulonDB 10.7: Gene Form
   

ddpF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ddpD ddpF ddpC osmC ddpB

Gene      
Name: ddpF    Texpresso search in the literature
Synonym(s): ECK1477, G6777, b1483, yddO
Genome position(nucleotides): 1557112 <-- 1558038 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.58
External database links:  
ASAP:
ABE-0004947
ECHOBASE:
EB3547
OU-MICROARRAY:
b1483
PORTECO:
ddpF
REGULONDB:
b1483
STRING:
511145.b1483
M3D: ddpF
COLOMBOS: ddpF
PortEco: b1483


Product      
Name: putative D,D-dipeptide ABC transporter ATP-binding subunit DdpF
Synonym(s): DdpF, YddO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 34.621
Isoelectric point: 7.951
Motif(s):
 
Type Positions Sequence
49 -> 56 GESGCGKS
33 -> 171 NGIDLQIRRGETLGIVGESGCGKSTLAQLLMGMLQPSHGQYIRSGSQRIMQMVFQDPLSSLNPRLPVWRIITEPLWIAKRSSEQQRRALAEELAVQVGIRPEYLDRLPHAFSGGQRQRIAIARALSSQPDVIVLDEPTS
163 -> 170 VIVLDEPT
8 -> 243 LRDVHINFPARKNWLGKTTEHVHAINGIDLQIRRGETLGIVGESGCGKSTLAQLLMGMLQPSHGQYIRSGSQRIMQMVFQDPLSSLNPRLPVWRIITEPLWIAKRSSEQQRRALAEELAVQVGIRPEYLDRLPHAFSGGQRQRIAIARALSSQPDVIVLDEPTSALDISVQAQILNLLVTLQENHGLTYVLISHNVSVIRHMSDRVAVMYLGQIVELGDAQQVLTAPAHPYTRLLL
222 -> 287 VELGDAQQVLTAPAHPYTRLLLDSLPAIDKPLEEEWALRKTDLPGNRTLPQGCFFYERCPLATHGC

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0015031 - protein transport
GO:0015833 - peptide transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YDDO-MONOMER
ECOLIWIKI:
b1483
INTERPRO:
IPR013563
INTERPRO:
IPR003593
INTERPRO:
IPR003439
INTERPRO:
IPR017871
INTERPRO:
IPR027417
MODBASE:
P77622
PFAM:
PF08352
PFAM:
PF00005
PRIDE:
P77622
PROSITE:
PS50893
PROSITE:
PS00211
PROTEINMODELPORTAL:
P77622
REFSEQ:
NP_416000
SMART:
SM00382
SMR:
P77622
UNIPROT:
P77622


Operon      
Name: ddpXABCDF         
Operon arrangement:
Transcription unit        Promoter
ddpXABCDF
ddpXABCDF
ddpXABCDF


Transcriptional Regulation      
Display Regulation             
Activated by: NtrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB