RegulonDB RegulonDB 10.7: Gene Form
   

ddpC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ddpA ddpB ddpD ddpF ddpC

Gene      
Name: ddpC    Texpresso search in the literature
Synonym(s): ECK1479, G6779, b1485, yddQ
Genome position(nucleotides): 1559014 <-- 1559910 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.07
External database links:  
ASAP:
ABE-0004953
ECHOBASE:
EB3549
OU-MICROARRAY:
b1485
PORTECO:
ddpC
REGULONDB:
b1485
STRING:
511145.b1485
M3D: ddpC
COLOMBOS: ddpC
PortEco: b1485


Product      
Name: putative D,D-dipeptide ABC transporter membrane subunit DdpC
Synonym(s): DdpC, YddQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 31.971
Isoelectric point: 9.999
Motif(s):
 
Type Positions Sequence
261 -> 281 WWYCAFPGAAILLTAVGFNLF
26 -> 70 MLKGSPLTVTSAVIIVLMLLMMIFSPWLATHDPNAIDLTARLLPP
146 -> 166 MALAAALGPSLFNAMLAIAIV
97 -> 282 ILAGLVVVAIAGMIGSLLGCLSGVLGGRADAIIMRIMDIMLSIPSLVLTMALAAALGPSLFNAMLAIAIVRIPFYVRLARGQALVVRQYTYVQAAKTFGASRWHLINWHILRNSLPPLIVQASLDIGSAILMAATLGFIGLGAQQPSAEWGAMVANGRNYVLDQWWYCAFPGAAILLTAVGFNLFG
218 -> 238 ASLDIGSAILMAATLGFIGLG

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0071916 - dipeptide transmembrane transporter activity
biological_process GO:0015031 - protein transport
GO:0015833 - peptide transport
GO:0055085 - transmembrane transport
GO:0035442 - dipeptide transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YDDQ-MONOMER
ECOLIWIKI:
b1485
INTERPRO:
IPR000515
INTERPRO:
IPR025966
INTERPRO:
IPR035906
PFAM:
PF12911
PFAM:
PF00528
PRIDE:
P77463
PROSITE:
PS50928
PROTEINMODELPORTAL:
P77463
REFSEQ:
NP_416002
UNIPROT:
P77463


Operon      
Name: ddpXABCDF         
Operon arrangement:
Transcription unit        Promoter
ddpXABCDF
ddpXABCDF
ddpXABCDF


Transcriptional Regulation      
Display Regulation             
Activated by: NtrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB