RegulonDB RegulonDB 10.7: Gene Form
   

uidR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uidA hdhA uidR uidB UidR CRP UxuR uidRp uidRp TSS_1898 TSS_1898 uidAp uidAp

Gene      
Name: uidR    Texpresso search in the literature
Synonym(s): ECK1613, G6867, b1618, gusR
Genome position(nucleotides): 1696462 <-- 1697052 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.93
External database links:  
ASAP:
ABE-0005415
ECHOBASE:
EB2533
OU-MICROARRAY:
b1618
PORTECO:
uidR
REGULONDB:
b1618
STRING:
511145.b1618
M3D: uidR
COLOMBOS: uidR
PortEco: b1618


Product      
Name: DNA-binding transcriptional repressor UidR
Synonym(s): GusR, UidR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: TetR/AcrR
Cellular location: cytosol
Molecular weight: 21.799
Isoelectric point: 5.944
Motif(s):
 
Type Positions Sequence
10 -> 70 QPTRTRILNAAREIFSENGFHSASMKAICKSCAISPGTLYHHFISKEALIQAIILQDQERA
33 -> 52 SMKAICKSCAISPGTLYHHF
16 -> 62 ILNAAREIFSENGFHSASMKAICKSCAISPGTLYHHFISKEALIQAI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [GEA] Gene expression analysis
[IEP] Inferred from expression pattern
Reference(s): [1] Blanco C. 1987
[2] Blanco C., et al., 1985
[3] Blanco C., et al., 1986
[4] Blanco C., et al., 1982
[5] Novel M., et al., 1976
[6] Novel M., et al., 1976
External database links:  
DIP:
DIP-48053N
ECOCYC:
G6867-MONOMER
ECOLIWIKI:
b1618
INTERPRO:
IPR036271
INTERPRO:
IPR009057
INTERPRO:
IPR023772
INTERPRO:
IPR001647
MINT:
MINT-1223157
MODBASE:
P0ACT6
PANTHER:
PTHR30328
PFAM:
PF00440
PRIDE:
P0ACT6
PRINTS:
PR00455
PRODB:
PRO_000024174
PROSITE:
PS01081
PROSITE:
PS50977
PROTEINMODELPORTAL:
P0ACT6
REFSEQ:
NP_416135
SMR:
P0ACT6
UNIPROT:
P0ACT6


Operon      
Name: uidR         
Operon arrangement:
Transcription unit        Promoter
uidR


Transcriptional Regulation      
Display Regulation             
Repressed by: UidR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1898 1697074 reverse nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Blanco C., 1987, Transcriptional and translational signals of the uidA gene in Escherichia coli K12., Mol Gen Genet 208(3):490-8

 [2] Blanco C., Mata-Gilsinger M., Ritzenthaler P., 1985, The use of gene fusions to study the expression of uidR, a negative regulatory gene of Escherichia coli K-12., Gene 36(1-2):159-67

 [3] Blanco C., Ritzenthaler P., Mata-Gilsinger M., 1986, Negative dominant mutations of the uidR gene in Escherichia coli: genetic proof for a cooperative regulation of uidA expression., Genetics 112(2):173-82

 [4] Blanco C., Ritzenthaler P., Mata-Gilsinger M., 1982, Cloning and endonuclease restriction analysis of uidA and uidR genes in Escherichia coli K-12: determination of transcription direction for the uidA gene., J Bacteriol 149(2):587-94

 [5] Novel M., Novel G., 1976, Regulation of beta-glucuronidase synthesis in Escherichia coli K-12: constitutive mutants specifically derepressed for uidA expression., J Bacteriol 127(1):406-17

 [6] Novel M., Novel G., 1976, Regulation of beta-glucuronidase synthesis in Escherichia coli K-12: pleiotropic constitutive mutations affecting uxu and uidA expression., J Bacteriol 127(1):418-32

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB