RegulonDB RegulonDB 10.6.3: Gene Form
   

ynjC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynjC ynjE ynjB ynjD ynjA ynjEp ynjEp

Gene      
Name: ynjC    Texpresso search in the literature
Synonym(s): ECK1753, G6950, b1755
Genome position(nucleotides): 1837212 --> 1838747 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.77
External database links:  
ASAP:
ABE-0005843
ECHOBASE:
EB3761
ECOCYC:
G6950
ECOLIHUB:
ynjC
OU-MICROARRAY:
b1755
REGULONDB:
b1755
STRING:
511145.b1755
M3D: ynjC
COLOMBOS: ynjC
PortEco: b1755


Product      
Name: putative ABC transporter membrane subunit YnjC
Synonym(s): YnjC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 56.243
Isoelectric point: 9.955
Motif(s):
 
Type Positions Sequence
190 -> 210 LAMAMLAIVAWSLSVVDVAII
92 -> 112 LPWLLAIPHVAFATSALLLFA
319 -> 339 LTMGLVATFIALLLLLLWLEW
346 -> 503 LWLWLPILLPALPLVAGQYTLALWLKLDGSWTAVVWGHLLWVMPWMLFILQPAWQRIDSRLILIAQTLGWSRAKIFFYVKCPLMLRPVLIAFAVGFAVGIAQYMPTLWLGAGRFPTLTTEAVALSSGGSNGILAAQALWQLLLPLIIFALTALVAKWV
433 -> 453 VLIAFAVGFAVGIAQYMPTLW

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
biological_process GO:0006810 - transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YNJC-MONOMER
ECOLIWIKI:
b1755
INTERPRO:
IPR035906
INTERPRO:
IPR000515
PFAM:
PF00528
PRIDE:
P76224
PROSITE:
PS50928
PROTEINMODELPORTAL:
P76224
REFSEQ:
NP_416269
SMR:
P76224
UNIPROT:
P76224


Operon      
Name: ydjXYZ-ynjABCD         
Operon arrangement:
Transcription unit        Promoter
null


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB